Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNRPN Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P63162
Molecular weight:
21.98 kDa

Original price was: €428.00.Current price is: €329.00.

100ug 23% OFF + 329 loyalty points
Thr2–Gly84
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNRPN Protein, N-His-SUMO

Product name ARO-P11924-100
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms SNRPN, HCERN3, Sm-N, Sm-D, SmN, Sm protein D, Small nuclear ribonucleoprotein-associated protein N, snRNP-N, Sm protein N, SMN, Tissue-specific-splicing protein
Reference ARO-P11924
Note For research use only.
Molecular Constructor
Thr2–Gly84
Product name ARO-P11924-1MG
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms SNRPN, HCERN3, Sm-N, Sm-D, SmN, Sm protein D, Small nuclear ribonucleoprotein-associated protein N, snRNP-N, Sm protein N, SMN, Tissue-specific-splicing protein
Reference ARO-P11924
Note For research use only.
Molecular Constructor
Thr2–Gly84
Product name ARO-P11924-50
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms SNRPN, HCERN3, Sm-N, Sm-D, SmN, Sm protein D, Small nuclear ribonucleoprotein-associated protein N, snRNP-N, Sm protein N, SMN, Tissue-specific-splicing protein
Reference ARO-P11924
Note For research use only.
Molecular Constructor
Thr2–Gly84

Introduction

Recombinant Human SNRPN Protein is a highly purified, biologically active protein that is produced using recombinant DNA technology. This protein is a member of the small nuclear ribonucleoprotein family and is encoded by the SNRPN gene located on chromosome 15. It plays a crucial role in the processing of precursor messenger RNA (pre-mRNA) and is involved in various cellular processes such as RNA splicing, transcription, and translation. In this article, we will discuss the structure, activity, and applications of Recombinant Human SNRPN Protein.

Structure of Recombinant Human SNRPN Protein

The Recombinant Human SNRPN Protein is a 95 amino acid protein with a molecular weight of approximately 11 kDa. It contains a conserved RNA-binding domain and a glycine-rich region that is essential for its function. The protein has an N-terminal domain that binds to RNA and a C-terminal domain that interacts with other proteins. The crystal structure of this protein has been determined, and it forms a complex with other proteins to form the small nuclear ribonucleoprotein (snRNP) complex.

Activity of Recombinant Human SNRPN Protein

The main function of Recombinant Human SNRPN Protein is to facilitate the processing of pre-mRNA into mature mRNA. It binds to specific sequences on the pre-mRNA and recruits other proteins to form the snRNP complex. This complex then catalyzes the splicing of introns, which are non-coding regions of the pre-mRNA, to produce mature mRNA. The mature mRNA can then be translated into proteins. In addition to its role in RNA splicing, Recombinant Human SNRPN Protein also plays a role in transcription and translation by interacting with other proteins that are involved in these processes.

Applications of Recombinant Human SNRPN Protein

Recombinant Human SNRPN Protein has various applications in both research and therapeutic settings.

Research Applications

Recombinant Human SNRPN Protein is widely used in research to study the mechanisms of RNA splicing and other cellular processes. It is also used to investigate the role of this protein in various diseases, including Prader-Willi syndrome, a genetic disorder caused by the loss of function of the SNRPN gene. This protein is also used to study its interactions with other proteins and its role in various signaling pathways.

Therapeutic Applications

Recombinant Human SNRPN Protein has potential therapeutic applications, particularly in the treatment of Prader-Willi syndrome. As this disorder is caused by the loss of function of the SNRPN gene, the administration of Recombinant Human SNRPN Protein may help restore its function and alleviate the symptoms of the disease. This protein has also been studied for its potential use in cancer therapy, as it plays a role in regulating cell growth and proliferation.

Conclusion

In conclusion, Recombinant Human SNRPN Protein is a crucial protein involved in various cellular processes, particularly in the processing of pre-mRNA. Its structure, activity, and applications make it a valuable tool in research and a potential therapeutic agent for certain diseases. Further studies on this protein may uncover more of its functions and potential applications in the future.

Recombinant Human SNRPN Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SNRPN Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products