Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRIM9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9C026
Molecular weight:
21.25 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Asp541–Ala710
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRIM9 Protein, N-His

Product name ARO-P11682-100
Uniprot ID Q9C026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Molecular weight 21.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp541-Ala710
Aliases /Synonyms Tripartite motif-containing protein 9, RING-type E3 ubiquitin transferase TRIM9, RNF91, RING finger protein 91, TRIM9, KIAA0282, E3 ubiquitin-protein ligase TRIM9
Reference ARO-P11682
Note For research use only.
Molecular Constructor
Asp541–Ala710
Product name ARO-P11682-1MG
Uniprot ID Q9C026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Molecular weight 21.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp541-Ala710
Aliases /Synonyms Tripartite motif-containing protein 9, RING-type E3 ubiquitin transferase TRIM9, RNF91, RING finger protein 91, TRIM9, KIAA0282, E3 ubiquitin-protein ligase TRIM9
Reference ARO-P11682
Note For research use only.
Molecular Constructor
Asp541–Ala710
Product name ARO-P11682-50
Uniprot ID Q9C026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Molecular weight 21.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp541-Ala710
Aliases /Synonyms Tripartite motif-containing protein 9, RING-type E3 ubiquitin transferase TRIM9, RNF91, RING finger protein 91, TRIM9, KIAA0282, E3 ubiquitin-protein ligase TRIM9
Reference ARO-P11682
Note For research use only.
Molecular Constructor
Asp541–Ala710

Introduction

Recombinant Human TRIM9 Protein is a highly versatile and important protein in the field of molecular biology. It is a member of the tripartite motif (TRIM) protein family, which plays a crucial role in regulating various cellular processes such as protein degradation, cell signaling, and innate immunity. In this article, we will provide a detailed description of the structure, activity, and application of Recombinant Human TRIM9 Protein.

Structure of Recombinant Human TRIM9 Protein

The gene encoding for TRIM9 is located on chromosome 11 in humans and is composed of 12 exons. The protein itself is composed of 861 amino acids and has a predicted molecular weight of approximately 97 kDa. It contains a tripartite motif consisting of a RING domain, B-box domain, and coiled-coil domain, which are characteristic of all TRIM proteins. These domains are involved in protein-protein interactions and are essential for the function of TRIM9.

Additionally, Recombinant Human TRIM9 Protein contains a C-terminal PRY-SPRY domain, which is unique to TRIM9 and is responsible for its substrate specificity. This domain is involved in the recognition and binding of specific target proteins, making TRIM9 a highly specific and selective protein.

Activity of Recombinant Human TRIM9 Protein

Recombinant Human TRIM9 Protein has been shown to have multiple functions in various cellular processes. One of its main activities is its role in protein degradation. TRIM9 has been found to act as an E3 ubiquitin ligase, which is responsible for tagging proteins with ubiquitin for degradation by the proteasome. This function is crucial for maintaining cellular homeostasis and regulating the levels of various proteins within the cell.

In addition to its role in protein degradation, Recombinant Human TRIM9 Protein also plays a role in cell signaling. It has been shown to interact with and regulate the activity of several signaling proteins, including the tumor suppressor protein p53 and the transcription factor NF-κB. This highlights the importance of TRIM9 in regulating cellular processes and its potential role in disease development and progression.

Application of Recombinant Human TRIM9 Protein

The unique structure and activity of Recombinant Human TRIM9 Protein make it a valuable tool in various research applications. Its ability to act as an E3 ubiquitin ligase makes it an important protein in studying protein degradation pathways and identifying potential therapeutic targets for diseases associated with protein degradation dysregulation.

Furthermore, the specific binding and interaction of TRIM9 with target proteins make it a useful tool in studying protein-protein interactions and identifying novel signaling pathways. This can aid in understanding disease mechanisms and developing targeted therapies.

Moreover, Recombinant Human TRIM9 Protein has potential diagnostic and prognostic applications. Its involvement in various cellular processes and its dysregulation in diseases such as cancer make it a potential biomarker for disease diagnosis and progression monitoring.

Conclusion

In summary, Recombinant Human TRIM9 Protein is a highly versatile and important protein in molecular biology. Its unique structure, activity, and potential applications make it a valuable tool in various research areas. Further studies on this protein may provide valuable insights into disease mechanisms and potential therapeutic targets for various diseases.

Recombinant Human TRIM9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRIM9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products