Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UMPS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P11172
Molecular weight:
30.06 kDa

Original price was: €226.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Ser226–Val480
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UMPS Protein, N-His

Product name ARO-P11675-100
Uniprot ID P11172
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Molecular weight 30.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser226-Val480
Aliases /Synonyms OMPdecase, OPRT, OPRTase, UMP synthase, ODC, Uridine 5'-monophosphate synthase, UMPS
Reference ARO-P11675
Note For research use only.
Molecular Constructor
Ser226–Val480
Product name ARO-P11675-1MG
Uniprot ID P11172
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Molecular weight 30.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser226-Val480
Aliases /Synonyms OMPdecase, OPRT, OPRTase, UMP synthase, ODC, Uridine 5'-monophosphate synthase, UMPS
Reference ARO-P11675
Note For research use only.
Molecular Constructor
Ser226–Val480
Product name ARO-P11675-50
Uniprot ID P11172
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Molecular weight 30.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser226-Val480
Aliases /Synonyms OMPdecase, OPRT, OPRTase, UMP synthase, ODC, Uridine 5'-monophosphate synthase, UMPS
Reference ARO-P11675
Note For research use only.
Molecular Constructor
Ser226–Val480

Introduction to Recombinant Human UMPS Protein

Recombinant Human UMPS Protein, also known as Uridine Monophosphate Synthase (UMPS), is a key enzyme involved in the de novo pyrimidine biosynthesis pathway. This protein is responsible for the conversion of orotate to UMP, a crucial step in the production of RNA and DNA. Recombinant Human UMPS Protein is a highly purified and biologically active form of the enzyme, produced through genetic engineering techniques.

Structure of Recombinant Human UMPS Protein

Recombinant Human UMPS Protein is a homodimer composed of two identical subunits, each with a molecular weight of approximately 55 kDa. The protein contains a catalytic domain and a regulatory domain, both of which are essential for its activity. The catalytic domain is responsible for the conversion of orotate to UMP, while the regulatory domain helps to maintain the stability and activity of the enzyme.

Activity of Recombinant Human UMPS Protein

Recombinant Human UMPS Protein is a highly active enzyme with a specific activity of approximately 1000 units/mg. It is able to efficiently convert orotate to UMP, using glutamine as a nitrogen donor. This reaction is essential for the production of pyrimidine nucleotides, which are crucial for cellular processes such as DNA and RNA synthesis.

The activity of Recombinant Human UMPS Protein is regulated by various factors, including the availability of substrates, the presence of allosteric effectors, and post-translational modifications. The enzyme is also subject to feedback inhibition by its end product, UMP, which helps to maintain the balance of pyrimidine nucleotides in the cell.

Applications of Recombinant Human UMPS Protein

Recombinant Human UMPS Protein has a wide range of applications in both research and industrial settings. Its ability to efficiently produce UMP makes it a valuable tool for studying the de novo pyrimidine biosynthesis pathway. The enzyme can also be used in the production of nucleotides for use in various biotechnological processes.

One of the most significant applications of Recombinant Human UMPS Protein is in the treatment of cancer. The enzyme is a target for certain chemotherapeutic agents, which inhibit its activity and ultimately lead to cell death. Recombinant Human UMPS Protein can also be used in the development of new anti-cancer drugs, as it plays a crucial role in the proliferation of cancer cells.

In addition, Recombinant Human UMPS Protein has potential applications in the treatment of metabolic disorders such as Lesch-Nyhan syndrome, a rare genetic disorder caused by a deficiency of the enzyme. The use of recombinant protein therapy has shown promising results in pre-clinical studies and may offer a potential treatment for this and other metabolic disorders.

Conclusion

In summary, Recombinant Human UMPS Protein is a highly active and biologically significant enzyme involved in the de novo pyrimidine biosynthesis pathway. Its structure, activity, and applications make it a valuable tool in various fields of research and industry, particularly in the development of cancer treatments and potential therapies for metabolic disorders. Further studies on this enzyme may lead to a better understanding of its role in cellular processes and the development of new therapeutic strategies.

Recombinant Human UMPS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UMPS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products