Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6NXT4
Molecular weight:
23.51 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Ser247–Asp334
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep

Product name ARO-P11862-100
Uniprot ID Q6NXT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKD
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Asp334
Aliases /Synonyms ZnT-6, Solute carrier family 30 member 6, Zinc transporter 6, ZNT6, SLC30A6
Reference ARO-P11862
Note For research use only.
Molecular Constructor
Ser247–Asp334
Product name ARO-P11862-1MG
Uniprot ID Q6NXT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKD
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Asp334
Aliases /Synonyms ZnT-6, Solute carrier family 30 member 6, Zinc transporter 6, ZNT6, SLC30A6
Reference ARO-P11862
Note For research use only.
Molecular Constructor
Ser247–Asp334
Product name ARO-P11862-50
Uniprot ID Q6NXT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKD
Molecular weight 23.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser247-Asp334
Aliases /Synonyms ZnT-6, Solute carrier family 30 member 6, Zinc transporter 6, ZNT6, SLC30A6
Reference ARO-P11862
Note For research use only.
Molecular Constructor
Ser247–Asp334

Introduction

The Recombinant Human SLC30A6 Protein, also known as the Solute Carrier Family 30 Member 6 protein, is a type of protein that is produced using recombinant DNA technology. This protein belongs to the SLC30 family, which is a group of zinc transporters that play a crucial role in maintaining zinc homeostasis in the body. In this article, we will discuss the structure, activity, and applications of Recombinant Human SLC30A6 Protein.

Structure of Recombinant Human SLC30A6 Protein

The Recombinant Human SLC30A6 Protein is composed of 331 amino acids and has a molecular weight of 37.3 kDa. It is a transmembrane protein, which means it spans across the cell membrane. The protein has six transmembrane domains, with the N and C termini located on the cytoplasmic side of the membrane. The protein also contains a histidine-rich loop, which is responsible for binding and transporting zinc ions.

Activity of Recombinant Human SLC30A6 Protein

The main function of Recombinant Human SLC30A6 Protein is to transport zinc ions across the cell membrane. Zinc is an essential micronutrient that plays a crucial role in various cellular processes such as cell growth, DNA synthesis, and immune function. The SLC30 family of proteins, including SLC30A6, are responsible for maintaining the proper levels of zinc in the body by transporting it into and out of cells.

Recombinant Human SLC30A6 Protein is highly specific for zinc ions and has a high affinity for them. It binds to zinc ions in the cytoplasm and transports them across the cell membrane, either into the cell or out of the cell, depending on the zinc levels in the cell. This process is vital for maintaining the balance of zinc in the body, as too much or too little zinc can have detrimental effects on cellular function.

Applications of Recombinant Human SLC30A6 Protein

The activity of Recombinant Human SLC30A6 Protein in transporting zinc ions makes it a valuable tool in various research and medical applications. Here are some of its potential uses:

1. Recombinant Protein Production

Recombinant Human SLC30A6 Protein can be produced in large quantities using recombinant DNA technology. This protein can then be used in various research studies to understand its structure, function, and role in maintaining zinc homeostasis. It can also be used to study the effects of zinc deficiency or excess on cellular processes.

2. Antigen in Vaccine Development

Recombinant Human SLC30A6 Protein has been identified as a potential antigen in vaccine development for diseases such as tuberculosis and leprosy. Studies have shown that this protein is highly immunogenic, meaning it can elicit a strong immune response. Incorporating this protein into vaccines can potentially enhance their efficacy in preventing and treating these diseases.

3. Diagnostic Tool

The activity of Recombinant Human SLC30A6 Protein in transporting zinc ions can also be utilized in diagnostic tests. Zinc levels in the body can be indicative of certain diseases or conditions, and measuring the levels of this protein can help in diagnosing and monitoring these conditions.

4. Therapeutic Target

Abnormal zinc homeostasis has been linked to various diseases, including diabetes, Alzheimer’s disease, and cancer. Recombinant Human SLC30A6 Protein can serve as a therapeutic target for these diseases, as modulating its activity can potentially restore zinc balance and improve cellular function.

5. Biomarker for Zinc Deficiency

Zinc deficiency is a common micronutrient deficiency, especially in developing countries. Recombinant

Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human SLC30A6 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products