Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RPS3A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P61247
Molecular weight:
26.45 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Ser26–Gly233
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RPS3A Protein, N-His

Product name ARO-P11832-100
Uniprot ID P61247
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Gly233
Aliases /Synonyms 40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-P11832
Note For research use only.
Molecular Constructor
Ser26–Gly233
Product name ARO-P11832-1MG
Uniprot ID P61247
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Gly233
Aliases /Synonyms 40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-P11832
Note For research use only.
Molecular Constructor
Ser26–Gly233
Product name ARO-P11832-50
Uniprot ID P61247
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Gly233
Aliases /Synonyms 40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-P11832
Note For research use only.
Molecular Constructor
Ser26–Gly233

Title: Introduction to Recombinant Human RPS3A Protein

Recombinant Human RPS3A Protein, also known as ribosomal protein S3A, is a highly conserved protein that plays a crucial role in protein synthesis. It is a member of the small ribosomal subunit and is involved in the binding of mRNA and tRNA during translation. In recent years, this protein has gained significant attention in the scientific community due to its potential applications in various fields, including medicine and biotechnology. In this article, we will explore the structure, activity, and applications of Recombinant Human RPS3A Protein.

Title: Structure of Recombinant Human RPS3A Protein

The Recombinant Human RPS3A Protein is composed of 246 amino acids with a molecular weight of approximately 28 kDa. It has a characteristic beta-barrel structure with a globular N-terminal domain and an extended C-terminal domain. The N-terminal domain contains a highly conserved RNA-binding motif, while the C-terminal domain is involved in protein-protein interactions. The protein also has two zinc-binding domains, which are essential for its structural stability and function.

Title: Activity of Recombinant Human RPS3A Protein

The primary function of Recombinant Human RPS3A Protein is to bind to the 3′ untranslated region (UTR) of mRNA and facilitate the recruitment of the small ribosomal subunit during translation. It also plays a crucial role in the initiation and elongation phases of protein synthesis. Additionally, this protein has been shown to interact with various other cellular proteins, including transcription factors and DNA repair enzymes, indicating its involvement in other cellular processes.

Title: Applications of Recombinant Human RPS3A Protein

Recombinant Human RPS3A Protein has a wide range of applications in both basic research and industrial settings. One of the main applications of this protein is in the production of recombinant proteins. As it is a critical component of the translation machinery, it can be used to optimize protein expression in various expression systems. It has also been utilized in the development of novel protein production platforms, such as cell-free protein synthesis systems.

In the field of medicine, Recombinant Human RPS3A Protein has shown promise as a potential therapeutic target for various diseases. Studies have demonstrated its role in cancer progression and metastasis, making it a potential target for cancer treatment. Additionally, this protein has been linked to neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, and could be a potential target for drug development.

Title: Recombinant Human RPS3A Protein as an Antigen

Recombinant Human RPS3A Protein has also been used as an antigen in various immunological studies. It has been shown to induce a strong immune response in animal models, making it a potential candidate for vaccine development. It has also been used as a diagnostic tool for certain autoimmune diseases, where antibodies against this protein have been detected in patient samples.

Title: Conclusion

In conclusion, Recombinant Human RPS3A Protein is a highly conserved protein with a crucial role in protein synthesis. Its unique structure and diverse functions make it a valuable tool for various applications, including protein production, drug development, and immunological studies. Further research on this protein could lead to a better understanding of its role in various cellular processes and potential therapeutic interventions.

Recombinant Human RPS3A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RPS3A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products