Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human RPS3A Polyclonal Antibody

  • ARO-A11994-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: €155.00.Current price is: €118.00.

50ug 24% OFF + 118 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human RPS3A Polyclonal Antibody

Product name ARO-A11994-100
Uniprot ID P61247
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-A11994
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human RPS3A (Ser26-Gly233).
Product name ARO-A11994-1MG
Uniprot ID P61247
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-A11994
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human RPS3A (Ser26-Gly233).
Product name ARO-A11994-50
Uniprot ID P61247
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-A11994
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human RPS3A (Ser26-Gly233).

Anti-Human RPS3A Polyclonal Antibody binds to Recombinant Human RPS3A Protein, N-His in WB Assay

Anti-Human RPS3A Polyclonal Antibody binds to Recombinant Human RPS3A Protein, N-His in WB Assay

Recombinant Human RPS3A Protein, N-His(cat. No.ARO-P11832) can bind Anti-Human RPS3A Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-Human RPS3A Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products