Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human S100A13, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99584
Molecular weight:
13.65 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Ala2–Lys98
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human S100A13, N-His

Product name ARO-P13159-100
Uniprot ID Q99584
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Molecular weight 13.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys98
Aliases /Synonyms Protein S100-A13, S100 calcium-binding protein A13, S100A13
Reference ARO-P13159
Note For research use only.
Molecular Constructor
Ala2–Lys98
Product name ARO-P13159-1MG
Uniprot ID Q99584
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Molecular weight 13.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys98
Aliases /Synonyms Protein S100-A13, S100 calcium-binding protein A13, S100A13
Reference ARO-P13159
Note For research use only.
Molecular Constructor
Ala2–Lys98
Product name ARO-P13159-50
Uniprot ID Q99584
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Molecular weight 13.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys98
Aliases /Synonyms Protein S100-A13, S100 calcium-binding protein A13, S100A13
Reference ARO-P13159
Note For research use only.
Molecular Constructor
Ala2–Lys98

Introduction

Recombinant human S100A13 is a protein that plays a crucial role in various cellular processes such as cell growth, proliferation, and differentiation. It belongs to the S100 protein family, which is characterized by the presence of two calcium-binding EF-hand motifs. S100A13 is known to interact with a variety of target proteins, making it a key player in many cellular pathways. In this article, we will delve into the structure, activity, and applications of recombinant human S100A13.

Structure of Recombinant Human S100A13

The gene for S100A13 is located on chromosome 1q21 and encodes a protein of 98 amino acids. The recombinant form of S100A13 is produced by cloning the gene into an expression vector and expressing it in a suitable host organism, such as Escherichia coli. The resulting protein is then purified using various chromatography techniques to obtain a highly pure and active form of S100A13.

The crystal structure of S100A13 has been determined, revealing a homodimeric structure with each monomer consisting of two EF-hand motifs connected by a flexible linker region. The two EF-hand motifs are responsible for binding calcium ions, which are essential for the proper functioning of S100A13.

Activity of Recombinant Human S100A13

S100A13 is a calcium-binding protein that regulates various cellular processes through its interactions with other proteins. One of its main functions is to act as a chaperone for the secretion of fibroblast growth factor 1 (FGF1), a potent mitogen involved in cell growth and differentiation. S100A13 binds to FGF1 and facilitates its transport to the cell surface, where it can exert its biological effects.

In addition to its role in FGF1 secretion, S100A13 has also been shown to interact with other proteins involved in cell signaling, such as annexins and integrins. It has been implicated in various cellular processes, including cell adhesion, migration, and invasion.

Applications of Recombinant Human S100A13

The unique properties of S100A13 make it a valuable tool for various research and diagnostic applications. The recombinant form of S100A13 is widely used in biochemical and biophysical studies to investigate its structure and function. It is also used in cell culture experiments to study its role in cellular processes such as cell proliferation and migration.

Furthermore, S100A13 has been identified as a potential biomarker for various diseases, including cancer and neurodegenerative disorders. Its altered expression has been observed in several types of cancer, and it has been proposed as a potential diagnostic and prognostic marker for these diseases.

In addition, S100A13 has been investigated as a potential therapeutic target for cancer treatment. Inhibition of S100A13 has been shown to reduce cell proliferation and migration in cancer cells, making it a promising target for the development of novel anti-cancer drugs.

Conclusion

In summary, recombinant human S100A13 is a calcium-binding protein with diverse functions in various cellular processes. Its unique structure and activity make it a valuable tool for research and diagnostic applications. Furthermore, its potential as a biomarker and therapeutic target for various diseases make it an exciting area of study for future research.

Recombinant Human S100A13, N-His

There are no reviews yet.

Be the first to review “Recombinant Human S100A13, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products