Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RNASE7, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H1E1
Molecular weight:
16.47 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Lys31–Val155
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RNASE7, N-His

Product name ARO-P13114-100
Uniprot ID Q9H1E1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Molecular weight 16.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys31-Val155
Aliases /Synonyms Skin-derived antimicrobial protein 2, RNASE7, Ribonuclease 7, RNase 7, SAP-2
Reference ARO-P13114
Note For research use only.
Molecular Constructor
Lys31–Val155
Product name ARO-P13114-1MG
Uniprot ID Q9H1E1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Molecular weight 16.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys31-Val155
Aliases /Synonyms Skin-derived antimicrobial protein 2, RNASE7, Ribonuclease 7, RNase 7, SAP-2
Reference ARO-P13114
Note For research use only.
Molecular Constructor
Lys31–Val155
Product name ARO-P13114-50
Uniprot ID Q9H1E1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Molecular weight 16.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys31-Val155
Aliases /Synonyms Skin-derived antimicrobial protein 2, RNASE7, Ribonuclease 7, RNase 7, SAP-2
Reference ARO-P13114
Note For research use only.
Molecular Constructor
Lys31–Val155

The Structure, Activity, and Application of Recombinant Human RNASE7

Introduction

Recombinant Human RNASE7 is a protein that has been artificially produced using genetic engineering techniques. It belongs to the ribonuclease A superfamily and is a member of the RNase A family. This protein plays a crucial role in the innate immune response, and its recombinant form has been extensively studied for its potential therapeutic applications.

Structure of Recombinant Human RNASE7

Recombinant Human RNASE7 is a small protein consisting of 128 amino acids with a molecular weight of approximately 14 kDa. It has a compact globular structure with a three-dimensional fold that is highly conserved among members of the RNase A family. The protein contains eight cysteine residues that form four disulfide bonds, which are essential for maintaining its structure and stability.

Activity of Recombinant Human RNASE7

Recombinant Human RNASE7 is a potent antimicrobial protein that exhibits broad-spectrum activity against bacteria, fungi, and viruses. It exerts its antimicrobial effects by degrading the RNA of pathogens, disrupting their protein synthesis and ultimately leading to their death. This protein has been shown to be particularly effective against drug-resistant bacteria, making it a promising candidate for the development of new antibiotics.

In addition to its antimicrobial activity, Recombinant Human RNASE7 also possesses immunomodulatory properties. It can stimulate the production of cytokines and chemokines, which are important mediators of the immune response. This protein also plays a role in wound healing by promoting the migration and proliferation of keratinocytes, the cells responsible for repairing damaged skin.

Application of Recombinant Human RNASE7

The unique properties of Recombinant Human RNASE7 make it a promising candidate for various therapeutic applications. Its potent antimicrobial activity has led to its investigation as a potential treatment for bacterial infections, including those caused by drug-resistant strains. It has also shown promise in the treatment of fungal and viral infections.

Furthermore, Recombinant Human RNASE7 has been studied for its potential in the treatment of inflammatory skin disorders, such as psoriasis and atopic dermatitis. Its immunomodulatory properties make it a promising candidate for these conditions, as it can regulate the immune response and reduce inflammation.

In addition to its therapeutic applications, Recombinant Human RNASE7 has also been used in research as a tool for studying RNA degradation and the role of RNase A family proteins in the innate immune response. Its recombinant form allows for easier production and purification, making it a valuable resource for studying the structure and function of this protein.

Conclusion

In summary, Recombinant Human RNASE7 is a small protein with a compact globular structure that exhibits potent antimicrobial and immunomodulatory properties. Its potential therapeutic applications include the treatment of bacterial, fungal, and viral infections, as well as inflammatory skin disorders. Its recombinant form has also been essential in research, providing valuable insights into the structure and function of this protein. With further studies and advancements in technology, Recombinant Human RNASE7 has the potential to become a valuable tool in the fight against infectious diseases and inflammatory disorders.

Recombinant Human RNASE7, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RNASE7, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products