Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FNDC1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q4ZHG4
Molecular weight:
27.62 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Ala33–Asp258
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FNDC1 Protein, N-His

Product name ARO-P12653-100
Uniprot ID Q4ZHG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAASVDHPLKPRHVKLLSTKMGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVSRPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGRSQPVYRAALTKRKISEED
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Asp258
Aliases /Synonyms KIAA1866, Expressed in synovial lining protein, MEL4B3, FNDC2, FNDC1, Activation-associated cDNA protein, Fibronectin type III domain-containing protein 1
Reference ARO-P12653
Note For research use only.
Molecular Constructor
Ala33–Asp258
Product name ARO-P12653-1MG
Uniprot ID Q4ZHG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAASVDHPLKPRHVKLLSTKMGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVSRPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGRSQPVYRAALTKRKISEED
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Asp258
Aliases /Synonyms KIAA1866, Expressed in synovial lining protein, MEL4B3, FNDC2, FNDC1, Activation-associated cDNA protein, Fibronectin type III domain-containing protein 1
Reference ARO-P12653
Note For research use only.
Molecular Constructor
Ala33–Asp258
Product name ARO-P12653-50
Uniprot ID Q4ZHG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAASVDHPLKPRHVKLLSTKMGLKVTWDPPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVSRPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAPRLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGRSQPVYRAALTKRKISEED
Molecular weight 27.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Asp258
Aliases /Synonyms KIAA1866, Expressed in synovial lining protein, MEL4B3, FNDC2, FNDC1, Activation-associated cDNA protein, Fibronectin type III domain-containing protein 1
Reference ARO-P12653
Note For research use only.
Molecular Constructor
Ala33–Asp258

Introduction

Recombinant Human FNDC1 Protein is a highly versatile and valuable tool in the field of biotechnology. It is a protein that has been produced through recombinant DNA technology, making it a synthetic version of the naturally occurring FNDC1 protein. This protein has gained significant attention in recent years due to its unique structure, diverse biological activities, and potential applications in various fields.

Structure of Recombinant Human FNDC1 Protein

The recombinant human FNDC1 protein is composed of 467 amino acids and has a molecular weight of 52 kDa. It belongs to the fibronectin type III domain-containing protein family and contains three fibronectin type III domains, which are known to be involved in cell adhesion and signaling processes. The protein also has a signal peptide at its N-terminus, which allows for its secretion from cells, and a transmembrane domain at its C-terminus, which anchors it to the cell membrane.

Activity of Recombinant Human FNDC1 Protein

The primary function of FNDC1 protein is to regulate cell adhesion and migration. It does so by interacting with integrins, a type of cell surface receptor, and other extracellular matrix proteins. This interaction promotes the formation of focal adhesions, which are essential for cell adhesion and movement. Additionally, FNDC1 has been shown to play a role in cell proliferation, differentiation, and tissue development.

Moreover, recombinant human FNDC1 protein has been found to have anti-inflammatory properties. It can inhibit the production of pro-inflammatory cytokines and promote the production of anti-inflammatory cytokines, making it a potential therapeutic agent for inflammatory diseases.

Application of Recombinant Human FNDC1 Protein

The unique structure and diverse biological activities of recombinant human FNDC1 protein make it a valuable tool in various fields, including biotechnology, medicine, and research.

Biotechnology

In biotechnology, recombinant human FNDC1 protein is used as an antigen in the production of antibodies. Antibodies produced against this protein can be used for various applications, such as diagnostic assays, drug development, and targeted therapy.

Medicine

In medicine, recombinant human FNDC1 protein has potential applications in tissue engineering and regenerative medicine. Its ability to promote cell adhesion and tissue development makes it a promising candidate for promoting wound healing and tissue repair.

Research

Recombinant human FNDC1 protein is also a valuable tool for research purposes. It can be used to study the role of FNDC1 in various biological processes, such as cell adhesion, migration, and inflammation. Its anti-inflammatory properties also make it a potential target for drug discovery and development.

Conclusion

In summary, recombinant human FNDC1 protein is a versatile and valuable protein with a unique structure and diverse biological activities. Its potential applications in biotechnology, medicine, and research make it a promising tool in various fields. Further studies and research on this protein may lead to the development of new therapies and treatments for various diseases and conditions.

Recombinant Human FNDC1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FNDC1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products