Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EDB/EDB-FN Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P02751
Molecular weight:
12.28 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Glu1266–Pro1359
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EDB/EDB-FN Protein, N-His

Product name ARO-P12730-100
Uniprot ID P02751
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVP
Molecular weight 12.28 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu1266-Pro1359
Aliases /Synonyms Cold-insoluble globulin, CIG, FN, Fibronectin, FN1
Reference ARO-P12730
Note For research use only.
Molecular Constructor
Glu1266–Pro1359
Product name ARO-P12730-1MG
Uniprot ID P02751
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVP
Molecular weight 12.28 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu1266-Pro1359
Aliases /Synonyms Cold-insoluble globulin, CIG, FN, Fibronectin, FN1
Reference ARO-P12730
Note For research use only.
Molecular Constructor
Glu1266–Pro1359
Product name ARO-P12730-50
Uniprot ID P02751
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVP
Molecular weight 12.28 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu1266-Pro1359
Aliases /Synonyms Cold-insoluble globulin, CIG, FN, Fibronectin, FN1
Reference ARO-P12730
Note For research use only.
Molecular Constructor
Glu1266–Pro1359

Introduction

Recombinant Human EDB/EDB-FN Protein is a type of protein that is produced through genetic engineering techniques. It is derived from the human fibronectin protein and has been modified to contain the extra domain B (EDB) region. This protein has a unique structure and function, making it a valuable tool in various scientific applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human EDB/EDB-FN Protein.

Structure of Recombinant Human EDB/EDB-FN Protein

Recombinant Human EDB/EDB-FN Protein has a complex structure consisting of multiple domains and subdomains. The protein is composed of two subunits, alpha and beta, which are connected by disulfide bonds. The alpha subunit contains the EDB region, while the beta subunit contains the extra domain A (EDA) region. The EDB region is unique to this protein and is not found in other fibronectin proteins.

The EDB region is a 91 amino acid sequence that forms a loop structure. It is located between the ninth and tenth type III repeats of the fibronectin protein. This region is highly conserved and has been shown to play a role in cell adhesion and migration. The unique structure of the EDB region allows it to interact with various cell surface receptors, making it an important mediator of cell signaling.

Activity of Recombinant Human EDB/EDB-FN Protein

Recombinant Human EDB/EDB-FN Protein has been shown to have multiple activities in various biological processes. One of its main functions is to promote cell adhesion and migration. The EDB region of the protein binds to cell surface receptors, such as integrins, and helps in the attachment of cells to the extracellular matrix. This activity is crucial for wound healing, tissue regeneration, and embryonic development.

In addition to cell adhesion, Recombinant Human EDB/EDB-FN Protein has also been shown to have angiogenic properties. It promotes the formation of new blood vessels by stimulating the proliferation and migration of endothelial cells. This activity is important in tissue repair and regeneration, as well as in diseases such as cancer, where new blood vessel formation is necessary for tumor growth.

Furthermore, Recombinant Human EDB/EDB-FN Protein has been shown to have anti-inflammatory effects. It can inhibit the production of pro-inflammatory cytokines and chemokines, thus reducing inflammation in various disease conditions. This activity makes it a potential therapeutic agent for inflammatory diseases such as rheumatoid arthritis and multiple sclerosis.

Applications of Recombinant Human EDB/EDB-FN Protein

The unique structure and activity of Recombinant Human EDB/EDB-FN Protein make it a valuable tool in various scientific applications. One of its main applications is in the field of tissue engineering. The protein’s ability to promote cell adhesion and angiogenesis makes it useful for creating artificial tissues and organs. It can be incorporated into scaffolds to enhance cell attachment and vascularization, leading to better tissue regeneration.

In addition, Recombinant Human EDB/EDB-FN Protein has potential applications in drug delivery. Its ability to bind to cell surface receptors can be utilized to target specific cells or tissues, making it a promising carrier for targeted drug delivery. This can improve the efficacy and reduce the side effects of drugs.

Moreover, Recombinant Human EDB/EDB-FN Protein has been studied for its potential as a diagnostic tool. The EDB region is highly expressed in tumor tissues, making it a potential biomarker for cancer detection. The protein can also be used in imaging techniques, such as positron emission tomography (PET), to detect and monitor the progression of cancer.

Conclusion

In conclusion, Recombinant Human EDB/EDB-FN Protein is a unique protein with a complex structure and multiple activities. Its role in cell adhesion, angiogenesis, and inflammation makes

Recombinant Human EDB/EDB-FN Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EDB/EDB-FN Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products