Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AP1M1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BXS5
Molecular weight:
31.81 kDa

Original price was: €274.00.Current price is: €230.00.

50ug 16% OFF + 230 loyalty points
Met1–Pro258
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AP1M1, N-His

Product name ARO-P12794-100
Uniprot ID Q9BXS5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPP
Molecular weight 31.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro258
Aliases /Synonyms Clathrin coat-associated protein AP47, Adaptor-related protein complex 1 subunit mu-1, Mu-adaptin 1, Adaptor protein complex AP-1 subunit mu-1, Clathrin coat assembly protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu1A-adaptin, AP-1 complex subunit mu-1, CLTNM, AP1M1, Clathrin assembly protein complex 1 mu-1 medium chain 1, AP-mu chain family member mu1A
Reference ARO-P12794
Note For research use only.
Molecular Constructor
Met1–Pro258
Product name ARO-P12794-1MG
Uniprot ID Q9BXS5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPP
Molecular weight 31.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro258
Aliases /Synonyms Clathrin coat-associated protein AP47, Adaptor-related protein complex 1 subunit mu-1, Mu-adaptin 1, Adaptor protein complex AP-1 subunit mu-1, Clathrin coat assembly protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu1A-adaptin, AP-1 complex subunit mu-1, CLTNM, AP1M1, Clathrin assembly protein complex 1 mu-1 medium chain 1, AP-mu chain family member mu1A
Reference ARO-P12794
Note For research use only.
Molecular Constructor
Met1–Pro258
Product name ARO-P12794-50
Uniprot ID Q9BXS5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPP
Molecular weight 31.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro258
Aliases /Synonyms Clathrin coat-associated protein AP47, Adaptor-related protein complex 1 subunit mu-1, Mu-adaptin 1, Adaptor protein complex AP-1 subunit mu-1, Clathrin coat assembly protein AP47, Golgi adaptor HA1/AP1 adaptin mu-1 subunit, Mu1A-adaptin, AP-1 complex subunit mu-1, CLTNM, AP1M1, Clathrin assembly protein complex 1 mu-1 medium chain 1, AP-mu chain family member mu1A
Reference ARO-P12794
Note For research use only.
Molecular Constructor
Met1–Pro258

Introduction

Recombinant Human AP1M1 is a protein that plays a crucial role in intracellular trafficking and vesicle formation. It is a member of the Adaptor Protein 1 (AP1) complex, which is responsible for sorting and transporting proteins between different cellular compartments. AP1M1 is an essential component of this complex and is involved in the formation of clathrin-coated vesicles, which are responsible for the transport of proteins from the trans-Golgi network to the endosomes. In this article, we will discuss the structure, activity, and applications of Recombinant Human AP1M1.

Structure of Recombinant Human AP1M1

Recombinant Human AP1M1 is a 48 kDa protein that consists of 410 amino acids. It is composed of four subunits, including two large subunits (AP1M1 and AP1M2) and two small subunits (AP1S1 and AP1S2). The AP1M1 subunit contains a clathrin-binding motif, a phosphatidylinositol 4-phosphate (PI4P) binding domain, and a tyrosine-based sorting motif. These domains are essential for the function of AP1M1 in vesicle formation and protein sorting.

Activity of Recombinant Human AP1M1

Recombinant Human AP1M1 plays a crucial role in the formation of clathrin-coated vesicles. These vesicles are formed at the trans-Golgi network and are responsible for the transport of cargo proteins to the endosomes. AP1M1 interacts with clathrin, a protein that forms the coat of these vesicles, through its clathrin-binding motif. This interaction is essential for the recruitment of clathrin to the membrane and the formation of clathrin-coated pits. In addition, AP1M1 also interacts with PI4P through its PI4P binding domain. This interaction is crucial for the localization of AP1M1 to the trans-Golgi network and the formation of clathrin-coated vesicles.

Apart from its role in vesicle formation, Recombinant Human AP1M1 is also involved in protein sorting. It recognizes and binds to sorting signals on cargo proteins through its tyrosine-based sorting motif. This binding facilitates the packaging of cargo proteins into clathrin-coated vesicles and their transport to the endosomes. Furthermore, AP1M1 also interacts with other adaptor proteins, such as AP1S1 and AP1S2, to regulate the formation and function of the AP1 complex.

Applications of Recombinant Human AP1M1

Recombinant Human AP1M1 has various applications in the field of cell biology and biochemistry. It is commonly used as a tool to study the mechanisms of intracellular trafficking and protein sorting. Recombinant AP1M1 can be expressed and purified in large quantities, making it a valuable reagent for in vitro studies. It can also be used in cell-based assays to investigate the role of AP1M1 in vesicle formation and protein sorting.

Moreover, Recombinant Human AP1M1 has potential therapeutic applications. Mutations in the AP1M1 gene have been associated with neurological disorders such as autism and intellectual disability. Recombinant AP1M1 can be used to study these mutations and their effects on protein function, which can aid in the development of targeted therapies for these disorders.

In conclusion, Recombinant Human AP1M1 is a crucial protein involved in intracellular trafficking and protein sorting. Its structure and activity make it an essential component of the AP1 complex, which is responsible for the transport of proteins between cellular compartments. Recombinant AP1M1 has various applications in research and potential therapeutic uses, making it an important protein for further study.

Recombinant Human AP1M1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AP1M1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products