Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PTGES3/P23 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15185
Molecular weight:
20.86 kDa

Original price was: €253.00.Current price is: €230.00.

50ug 9% OFF + 230 loyalty points
Met1–Glu160
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PTGES3/P23 Protein, N-His

Product name ARO-P11928-100
Uniprot ID Q15185
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Molecular weight 20.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu160
Aliases /Synonyms PTGES3, Hsp90 co-chaperone, P23, Progesterone receptor complex p23, Prostaglandin E synthase 3, cPGES, Telomerase-binding protein p23, Cytosolic prostaglandin E2 synthase, TEBP
Reference ARO-P11928
Note For research use only.
Molecular Constructor
Met1–Glu160
Product name ARO-P11928-1MG
Uniprot ID Q15185
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Molecular weight 20.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu160
Aliases /Synonyms PTGES3, Hsp90 co-chaperone, P23, Progesterone receptor complex p23, Prostaglandin E synthase 3, cPGES, Telomerase-binding protein p23, Cytosolic prostaglandin E2 synthase, TEBP
Reference ARO-P11928
Note For research use only.
Molecular Constructor
Met1–Glu160
Product name ARO-P11928-50
Uniprot ID Q15185
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Molecular weight 20.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu160
Aliases /Synonyms PTGES3, Hsp90 co-chaperone, P23, Progesterone receptor complex p23, Prostaglandin E synthase 3, cPGES, Telomerase-binding protein p23, Cytosolic prostaglandin E2 synthase, TEBP
Reference ARO-P11928
Note For research use only.
Molecular Constructor
Met1–Glu160

Introduction

Recombinant Human PTGES3/P23 Protein, also known as Prostaglandin E Synthase 3, is a protein that plays a crucial role in the synthesis of prostaglandin E2 (PGE2), a hormone-like molecule involved in various physiological processes. This recombinant protein is produced through genetic engineering techniques, making it a valuable tool for research and therapeutic applications.

Structure of Recombinant Human PTGES3/P23 Protein

The recombinant PTGES3/P23 protein is a 23 kDa protein that consists of 199 amino acids. It has a conserved catalytic domain that is essential for its enzymatic activity. The protein also contains a hydrophobic transmembrane domain, which anchors it to the endoplasmic reticulum (ER) membrane. This unique structure allows the protein to function as a membrane-bound enzyme, unlike other prostaglandin synthases.

Activity of Recombinant Human PTGES3/P23 Protein

The main function of PTGES3/P23 protein is to catalyze the conversion of prostaglandin H2 (PGH2) to PGE2. This conversion involves the addition of a hydroxyl group to the cyclooxygenase (COX) product, resulting in the formation of PGE2. This process is crucial for maintaining the balance of PGE2 levels in the body, as PGE2 plays a key role in regulating inflammation, pain, and fever.

In addition to its role in PGE2 synthesis, PTGES3/P23 protein has been found to interact with other proteins involved in various cellular processes. It has been shown to interact with cytosolic phospholipase A2 (cPLA2), an enzyme involved in the production of arachidonic acid, a key precursor for prostaglandin synthesis. This interaction suggests that PTGES3/P23 protein may play a role in regulating the availability of arachidonic acid for PGE2 synthesis.

Application of Recombinant Human PTGES3/P23 Protein

The recombinant PTGES3/P23 protein has several applications in both research and therapeutic settings. Its ability to catalyze the conversion of PGH2 to PGE2 makes it a valuable tool for studying the role of PGE2 in various physiological processes. It can also be used to study the regulation of PGE2 synthesis and its interaction with other proteins.

In addition, the recombinant PTGES3/P23 protein has potential therapeutic applications. As PGE2 has been implicated in various diseases, such as inflammation, pain, and cancer, targeting the enzyme responsible for its synthesis, PTGES3/P23, could be a potential treatment strategy. Recombinant PTGES3/P23 protein can be used to develop inhibitors that can block its activity, thus reducing PGE2 levels and potentially alleviating symptoms of these diseases.

Furthermore, the recombinant PTGES3/P23 protein can also be used in the development of diagnostic assays for various diseases. As PGE2 levels have been found to be elevated in certain diseases, such as rheumatoid arthritis and certain types of cancer, measuring PGE2 levels in patient samples can aid in diagnosis and monitoring of these conditions. Recombinant PTGES3/P23 protein can be used as an antigen in these assays, allowing for the detection and quantification of PGE2 levels.

Conclusion

In summary, Recombinant Human PTGES3/P23 Protein is a 23 kDa protein that plays a crucial role in the synthesis of PGE2. Its unique structure and enzymatic activity make it a valuable tool for studying the role of PGE2 in various physiological processes. It also has potential therapeutic and diagnostic applications, making it a promising target for further research and development.

Recombinant Human PTGES3/P23 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PTGES3/P23 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products