Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CST1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P01037
Molecular weight:
25.67 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Asp41–Ser141
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CST1 Protein, N-His-SUMO & C-Strep

Product name ARO-P12246-100
Uniprot ID P01037
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Molecular weight 25.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp41-Ser141
Aliases /Synonyms Cystain-SA-I, CST1, Cystatin-1, Cystatin-SN, Salivary cystatin-SA-1
Reference ARO-P12246
Note For research use only.
Molecular Constructor
Asp41–Ser141
Product name ARO-P12246-1MG
Uniprot ID P01037
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Molecular weight 25.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp41-Ser141
Aliases /Synonyms Cystain-SA-I, CST1, Cystatin-1, Cystatin-SN, Salivary cystatin-SA-1
Reference ARO-P12246
Note For research use only.
Molecular Constructor
Asp41–Ser141
Product name ARO-P12246-50
Uniprot ID P01037
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Molecular weight 25.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp41-Ser141
Aliases /Synonyms Cystain-SA-I, CST1, Cystatin-1, Cystatin-SN, Salivary cystatin-SA-1
Reference ARO-P12246
Note For research use only.
Molecular Constructor
Asp41–Ser141

Introduction

Recombinant Human CST1 Protein is a synthetic version of the human cystatin S protein, which plays a crucial role in regulating protease activity in the body. This protein is produced through recombinant DNA technology, making it a valuable tool for research and therapeutic applications. In this article, we will explore the structure, activity, and applications of Recombinant Human CST1 Protein.

Structure of Recombinant Human CST1 Protein

The human CST1 gene encodes for a 98 amino acid protein, which is then processed into a mature protein consisting of 93 amino acids. The recombinant version of this protein is produced by inserting the human CST1 gene into a suitable expression system, such as bacteria or yeast. The resulting protein has the same amino acid sequence as the native human cystatin S protein, making it biologically active and functionally similar.

The structure of Recombinant Human CST1 Protein is that of a small, globular protein with a molecular weight of approximately 11 kDa. It contains four disulfide bonds, which are essential for maintaining its stability and inhibitory activity. The protein also has a flexible N-terminal region, which allows it to bind to a variety of proteases and regulate their activity.

Activity of Recombinant Human CST1 Protein

The primary function of cystatin S is to inhibit the activity of cysteine proteases, a group of enzymes involved in various physiological processes, including digestion, immune response, and tissue remodeling. Recombinant Human CST1 Protein has been shown to effectively inhibit the activity of several cysteine proteases, including cathepsin B, L, and H. This inhibition is achieved through the formation of a reversible complex between the cystatin S protein and the active site of the protease.

In addition to its inhibitory activity, Recombinant Human CST1 Protein also has anti-inflammatory properties. It has been shown to reduce the production of pro-inflammatory cytokines, such as TNF-α and IL-1β, and inhibit the activation of NF-κB, a key regulator of the inflammatory response. This makes it a potential therapeutic agent for inflammatory conditions, such as rheumatoid arthritis and inflammatory bowel disease.

Applications of Recombinant Human CST1 Protein

Recombinant Human CST1 Protein has a wide range of applications in both research and therapeutic settings. Its ability to inhibit cysteine proteases makes it a valuable tool for studying the role of these enzymes in various biological processes. It can also be used to screen for potential inhibitors of cysteine proteases, which may have therapeutic potential.

In the field of therapeutics, Recombinant Human CST1 Protein has shown promise as a potential treatment for diseases involving excessive protease activity, such as osteoarthritis and cancer. Its anti-inflammatory properties also make it a potential candidate for the treatment of inflammatory diseases. In addition, this protein has been studied for its potential role in neuroprotection, as it has been shown to inhibit the activity of cathepsin B, which is associated with neurodegenerative diseases.

Conclusion

In summary, Recombinant Human CST1 Protein is a synthetic version of the human cystatin S protein, produced through recombinant DNA technology. It has a similar structure and activity to the native protein, making it a valuable tool for research and therapeutic applications. Its ability to inhibit cysteine proteases and its anti-inflammatory properties make it a potential candidate for the treatment of various diseases. Further studies and research on this protein may reveal even more potential applications and benefits.

Recombinant Human CST1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CST1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products