Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CPSF4 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95639
Molecular weight:
21.07 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
His59–Ile121
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CPSF4 Protein, N-His-SUMO & C-Strep

Product name ARO-P12248-100
Uniprot ID O95639
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKI
Molecular weight 21.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His59-Ile121
Aliases /Synonyms CPSF4, CPSF 30 kDa subunit, Cleavage and polyadenylation specificity factor 30 kDa subunit, Neb-1, NS1 effector domain-binding protein 1, NAR, Cleavage and polyadenylation specificity factor subunit 4, CPSF30, No arches homolog, NEB1
Reference ARO-P12248
Note For research use only.
Molecular Constructor
His59–Ile121
Product name ARO-P12248-1MG
Uniprot ID O95639
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKI
Molecular weight 21.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His59-Ile121
Aliases /Synonyms CPSF4, CPSF 30 kDa subunit, Cleavage and polyadenylation specificity factor 30 kDa subunit, Neb-1, NS1 effector domain-binding protein 1, NAR, Cleavage and polyadenylation specificity factor subunit 4, CPSF30, No arches homolog, NEB1
Reference ARO-P12248
Note For research use only.
Molecular Constructor
His59–Ile121
Product name ARO-P12248-50
Uniprot ID O95639
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKI
Molecular weight 21.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His59-Ile121
Aliases /Synonyms CPSF4, CPSF 30 kDa subunit, Cleavage and polyadenylation specificity factor 30 kDa subunit, Neb-1, NS1 effector domain-binding protein 1, NAR, Cleavage and polyadenylation specificity factor subunit 4, CPSF30, No arches homolog, NEB1
Reference ARO-P12248
Note For research use only.
Molecular Constructor
His59–Ile121

Title: Introduction to Recombinant Human CPSF4 Protein

Recombinant Human CPSF4 Protein, also known as Cleavage and Polyadenylation Specificity Factor 4, is a highly conserved protein that plays a crucial role in the process of mRNA polyadenylation. This process is essential for the proper functioning of eukaryotic cells and is involved in various cellular processes such as gene expression, RNA processing, and mRNA stability. In this article, we will explore the structure, activity, and applications of Recombinant Human CPSF4 Protein.

Title: Structure of Recombinant Human CPSF4 Protein

Recombinant Human CPSF4 Protein is a 70 kDa protein consisting of 634 amino acids. It is composed of four domains: an N-terminal domain, a central RNA recognition motif (RRM), a linker region, and a C-terminal domain. The N-terminal domain is responsible for protein-protein interactions, while the RRM domain is involved in RNA binding. The linker region connects the two domains and is crucial for the overall stability of the protein. The C-terminal domain contains the catalytic site of the protein, which is responsible for its enzymatic activity.

Title: Activity of Recombinant Human CPSF4 Protein

Recombinant Human CPSF4 Protein is a key component of the cleavage and polyadenylation complex, which is responsible for the cleavage and polyadenylation of pre-mRNA. This process involves the recognition and binding of CPSF4 to the polyadenylation signal on the pre-mRNA. The RRM domain of CPSF4 interacts with the pre-mRNA, while the C-terminal domain catalyzes the cleavage of the pre-mRNA at the polyadenylation site. This results in the addition of a poly(A) tail to the mRNA, which is essential for its stability and proper functioning.

Title: Applications of Recombinant Human CPSF4 Protein

Recombinant Human CPSF4 Protein has various applications in both research and therapeutic settings. In research, it is commonly used as a tool to study the process of mRNA polyadenylation and its role in gene expression. It can also be used to investigate the effects of mutations or modifications in CPSF4 on its activity and function. Additionally, Recombinant Human CPSF4 Protein can be used to identify potential inhibitors or activators of the protein, which can aid in the development of new drugs targeting mRNA processing.

In the therapeutic field, Recombinant Human CPSF4 Protein has shown potential as a target for cancer therapy. Studies have found that CPSF4 is overexpressed in various types of cancer, and inhibiting its activity can lead to decreased cell proliferation and tumor growth. Furthermore, Recombinant Human CPSF4 Protein has been shown to play a role in viral infections, making it a potential target for antiviral drugs.

Title: Antigenicity of Recombinant Human CPSF4 Protein

Recombinant Human CPSF4 Protein is a highly antigenic protein, meaning it can elicit an immune response in the body. This property makes it a valuable tool in the development of vaccines against diseases caused by viruses that utilize the mRNA polyadenylation process, such as influenza and HIV. Additionally, the antigenicity of CPSF4 can be utilized in diagnostic tests for viral infections, as antibodies against the protein can be used to detect its presence in patient samples.

In conclusion, Recombinant Human CPSF4 Protein is a crucial component of the mRNA polyadenylation process, with various roles in gene expression, RNA processing, and disease. Its structure, activity, and applications make it a valuable tool in both research and therapeutic settings, and further studies on this protein can lead to a better understanding of its functions and potential as a target for drug development.

Recombinant Human CPSF4 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CPSF4 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products