Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FZR1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UM11
Molecular weight:
38.25 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Ser172–Arg496
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FZR1 Protein, N-His

Product name ARO-P12236-100
Uniprot ID Q9UM11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Arg496
Aliases /Synonyms FZR, hCDH1, Fizzy-related protein homolog, Cdh1/Hct1 homolog, Fzr, CDH1, CDC20-like protein 1, KIAA1242, FYR, FZR1
Reference ARO-P12236
Note For research use only.
Molecular Constructor
Ser172–Arg496
Product name ARO-P12236-1MG
Uniprot ID Q9UM11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Arg496
Aliases /Synonyms FZR, hCDH1, Fizzy-related protein homolog, Cdh1/Hct1 homolog, Fzr, CDH1, CDC20-like protein 1, KIAA1242, FYR, FZR1
Reference ARO-P12236
Note For research use only.
Molecular Constructor
Ser172–Arg496
Product name ARO-P12236-50
Uniprot ID Q9UM11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR
Molecular weight 38.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Arg496
Aliases /Synonyms FZR, hCDH1, Fizzy-related protein homolog, Cdh1/Hct1 homolog, Fzr, CDH1, CDC20-like protein 1, KIAA1242, FYR, FZR1
Reference ARO-P12236
Note For research use only.
Molecular Constructor
Ser172–Arg496

Introduction

Recombinant proteins are synthetic proteins that are produced in a laboratory using genetic engineering techniques. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and research. One such recombinant protein is the Recombinant Human FZR1 Protein, which has gained significant attention in the scientific community due to its unique structure and diverse functions.

Structure of Recombinant Human FZR1 Protein

The Recombinant Human FZR1 Protein is a 78 kDa protein that consists of 694 amino acids. It is a member of the F-box family of proteins, which play a crucial role in regulating the cell cycle and maintaining genomic stability. The FZR1 protein has a conserved F-box domain at the N-terminus and seven WD40 repeats at the C-terminus. These structural features allow the protein to interact with other proteins and form a complex, which is essential for its activity.

Activity of Recombinant Human FZR1 Protein

The FZR1 protein is a key regulator of the cell cycle, specifically the transition from the G2 phase to the M phase. It acts as a substrate recognition component of the anaphase-promoting complex/cyclosome (APC/C), which is responsible for the degradation of cell cycle regulators. The FZR1 protein recognizes and binds to specific proteins, such as cyclins and securins, and targets them for degradation by the APC/C. This process is crucial for maintaining the balance between cell proliferation and cell death, and any dysregulation can lead to various diseases, including cancer.

Application of Recombinant Human FZR1 Protein

The Recombinant Human FZR1 Protein has numerous applications in both research and medicine. Its role in regulating the cell cycle makes it a valuable tool for studying cell division and its dysregulation in diseases such as cancer. The protein can be used to investigate the mechanisms of cell cycle control and identify potential targets for therapeutic interventions.

In the field of medicine, the FZR1 protein has been studied for its potential as a biomarker for cancer diagnosis and prognosis. Studies have shown that alterations in the expression of FZR1 can be detected in various types of cancer, making it a promising candidate for early detection and monitoring of the disease.

Furthermore, the FZR1 protein has also been investigated for its therapeutic potential. Research has shown that targeting FZR1 can inhibit the growth of cancer cells and sensitize them to chemotherapy. This highlights the potential of FZR1 as a target for cancer treatment.

Conclusion

The Recombinant Human FZR1 Protein is a crucial player in the regulation of the cell cycle and has a wide range of applications in research and medicine. Its unique structure and activity make it a valuable tool for studying cell division and its dysregulation in diseases such as cancer. Further research on this protein can lead to a better understanding of the cell cycle and potential treatments for cancer and other diseases.

Recombinant Human FZR1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FZR1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products