Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HLA-F Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P30511
Molecular weight:
34.92 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Gly22–Pro304
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HLA-F Protein, N-His

Product name ARO-P12226-100
Uniprot ID P30511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIP
Molecular weight 34.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly22-Pro304
Aliases /Synonyms Leukocyte antigen F, CDA12, MHC class I antigen F, HLA F antigen, HLA-F, HLAF, HLA class I histocompatibility antigen, alpha chain F, HLA-5.4
Reference ARO-P12226
Note For research use only.
Molecular Constructor
Gly22–Pro304
Product name ARO-P12226-1MG
Uniprot ID P30511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIP
Molecular weight 34.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly22-Pro304
Aliases /Synonyms Leukocyte antigen F, CDA12, MHC class I antigen F, HLA F antigen, HLA-F, HLAF, HLA class I histocompatibility antigen, alpha chain F, HLA-5.4
Reference ARO-P12226
Note For research use only.
Molecular Constructor
Gly22–Pro304
Product name ARO-P12226-50
Uniprot ID P30511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIP
Molecular weight 34.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly22-Pro304
Aliases /Synonyms Leukocyte antigen F, CDA12, MHC class I antigen F, HLA F antigen, HLA-F, HLAF, HLA class I histocompatibility antigen, alpha chain F, HLA-5.4
Reference ARO-P12226
Note For research use only.
Molecular Constructor
Gly22–Pro304

Introduction

Recombinant Human HLA-F Protein, also known as Human Leukocyte Antigen-F, is a type I transmembrane glycoprotein that belongs to the major histocompatibility complex (MHC) class I family. It plays a crucial role in the immune system by presenting antigens to T cells, which are essential for initiating an immune response. In this article, we will discuss the structure, activity, and applications of Recombinant Human HLA-F Protein.

Structure of Recombinant Human HLA-F Protein

Recombinant Human HLA-F Protein is a heterodimer composed of two non-covalently linked chains: a heavy chain (45 kDa) and a light chain (12 kDa). The heavy chain contains three extracellular domains (α1, α2, and α3), a transmembrane domain, and a cytoplasmic tail. The α1 and α2 domains form the peptide-binding groove, while the α3 domain interacts with the T cell receptor. The light chain, also known as β2-microglobulin, is a small protein that stabilizes the heavy chain and is essential for antigen presentation.

Activity of Recombinant Human HLA-F Protein

Recombinant Human HLA-F Protein is primarily involved in the presentation of antigens to T cells. Antigens are small molecules, such as peptides, that are recognized by the immune system as foreign and elicit an immune response. The α1 and α2 domains of the heavy chain bind to the antigen, while the α3 domain interacts with the T cell receptor. This interaction triggers a series of events that lead to the activation of T cells, which then initiate an immune response to eliminate the foreign antigen.

In addition to antigen presentation, Recombinant Human HLA-F Protein also plays a role in regulating the activity of natural killer (NK) cells. NK cells are a type of immune cell that can directly kill infected or abnormal cells. The interaction between Recombinant Human HLA-F Protein and NK cells can either activate or inhibit their activity, depending on the specific receptors involved.

Applications of Recombinant Human HLA-F Protein

Recombinant Human HLA-F Protein has a wide range of applications in the field of immunology and medicine. One of its primary uses is in research, where it is used to study the immune response and the role of MHC class I molecules in antigen presentation. Recombinant Human HLA-F Protein can also be used to screen for potential antigens that can elicit an immune response, which is essential in the development of vaccines.

In the clinical setting, Recombinant Human HLA-F Protein has shown potential as a diagnostic marker for certain diseases. For example, abnormal expression of HLA-F has been observed in certain types of cancer, making it a potential biomarker for early detection and diagnosis. Additionally, Recombinant Human HLA-F Protein has been investigated as a potential therapeutic target for autoimmune diseases, as it plays a role in regulating the activity of T cells.

Conclusion

In conclusion, Recombinant Human HLA-F Protein is a crucial component of the immune system that is involved in antigen presentation and the regulation of immune cell activity. Its structure, activity, and applications make it a valuable tool in research and a potential diagnostic and therapeutic target in the clinical setting. Further studies on Recombinant Human HLA-F Protein may lead to a better understanding of the immune response and the development of new treatments for various diseases.

Recombinant Human HLA-F Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HLA-F Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products