Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DZIP1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86YF9
Molecular weight:
17.80 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Ser66–Asp114
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DZIP1 Protein, N-His-SUMO

Product name ARO-P11397-100
Uniprot ID Q86YF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVD
Molecular weight 17.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser66-Asp114
Aliases /Synonyms DAZ-interacting protein 1/2, DZIP1, Zinc finger protein DZIP1, DZIP, KIAA0996, DZIP2
Reference ARO-P11397
Note For research use only.
Molecular Constructor
Ser66–Asp114
Product name ARO-P11397-1MG
Uniprot ID Q86YF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVD
Molecular weight 17.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser66-Asp114
Aliases /Synonyms DAZ-interacting protein 1/2, DZIP1, Zinc finger protein DZIP1, DZIP, KIAA0996, DZIP2
Reference ARO-P11397
Note For research use only.
Molecular Constructor
Ser66–Asp114
Product name ARO-P11397-50
Uniprot ID Q86YF9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVD
Molecular weight 17.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser66-Asp114
Aliases /Synonyms DAZ-interacting protein 1/2, DZIP1, Zinc finger protein DZIP1, DZIP, KIAA0996, DZIP2
Reference ARO-P11397
Note For research use only.
Molecular Constructor
Ser66–Asp114

Introduction

Recombinant Human DZIP1 Protein, also known as DAZ-interacting protein 1, is a protein that is encoded by the DZIP1 gene in humans. It is a member of the DAZ family of proteins, which are involved in the regulation of germ cell development and male fertility. Recombinant Human DZIP1 Protein is produced through genetic engineering techniques, making it a highly purified and biologically active protein.

Structure of Recombinant Human DZIP1 Protein

Recombinant Human DZIP1 Protein is a 70 kDa protein consisting of 626 amino acids. It contains a DAZ-like domain, a conserved zinc finger domain, and a proline-rich region. The DAZ-like domain is responsible for the interaction with DAZ proteins, while the zinc finger domain is involved in RNA binding. The proline-rich region is thought to play a role in protein-protein interactions.

Activity of Recombinant Human DZIP1 Protein

Recombinant Human DZIP1 Protein is a key regulator of germ cell development and male fertility. It has been shown to interact with DAZ proteins, which are essential for spermatogenesis. DAZ proteins are RNA-binding proteins that are involved in the translation and stabilization of mRNAs that are critical for germ cell development. Recombinant Human DZIP1 Protein enhances the RNA-binding activity of DAZ proteins, thereby promoting the translation of specific mRNAs and ultimately leading to the development and maturation of sperm cells.

In addition to its role in germ cell development, Recombinant Human DZIP1 Protein has also been found to be involved in the regulation of the Wnt signaling pathway. This pathway plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. Recombinant Human DZIP1 Protein has been shown to interact with key components of the Wnt signaling pathway, such as β-catenin and GSK-3β, and modulate their activity. This suggests that Recombinant Human DZIP1 Protein may have a broader role in cellular signaling and development beyond its involvement in germ cell development.

Application of Recombinant Human DZIP1 Protein

Recombinant Human DZIP1 Protein has a wide range of potential applications in both research and therapeutic settings. Its role in germ cell development and male fertility makes it a valuable tool for studying the mechanisms of spermatogenesis and identifying potential targets for male infertility treatments.

Moreover, the interaction of Recombinant Human DZIP1 Protein with key components of the Wnt signaling pathway makes it a potential target for the development of novel therapies for diseases such as cancer. Dysregulation of the Wnt signaling pathway has been implicated in various types of cancer, and targeting Recombinant Human DZIP1 Protein could potentially lead to the development of more effective treatments.

In addition, Recombinant Human DZIP1 Protein has been used in in vitro studies to investigate its role in RNA binding and translation. Its ability to enhance the RNA-binding activity of DAZ proteins makes it a valuable tool for studying the regulation of gene expression and identifying potential therapeutic targets for diseases related to RNA dysregulation.

Conclusion

In summary, Recombinant Human DZIP1 Protein is a 70 kDa protein that plays a crucial role in germ cell development and male fertility. Its interaction with DAZ proteins and modulation of the Wnt signaling pathway make it a promising target for research and therapeutic applications. Its production through genetic engineering techniques ensures a highly pure and biologically active protein, making it a valuable tool for scientific studies. Further research on Recombinant Human DZIP1 Protein may lead to a better understanding of its role in cellular signaling and the development of new treatments for diseases related to germ cell development and RNA dysregulation.

Recombinant Human DZIP1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human DZIP1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products