Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ADAMTSL4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6UY14
Molecular weight:
15.48 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Asp481–Ser601
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ADAMTSL4 Protein, N-His

Product name ARO-P11396-100
Uniprot ID Q6UY14
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISS
Molecular weight 15.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp481-Ser601
Aliases /Synonyms ADAMTSL4, ADAMTS-like protein 4, ADAMTSL-4, TSRC1, Thrombospondin repeat-containing protein 1
Reference ARO-P11396
Note For research use only.
Molecular Constructor
Asp481–Ser601
Product name ARO-P11396-1MG
Uniprot ID Q6UY14
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISS
Molecular weight 15.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp481-Ser601
Aliases /Synonyms ADAMTSL4, ADAMTS-like protein 4, ADAMTSL-4, TSRC1, Thrombospondin repeat-containing protein 1
Reference ARO-P11396
Note For research use only.
Molecular Constructor
Asp481–Ser601
Product name ARO-P11396-50
Uniprot ID Q6UY14
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSTCRLVSGNLTDRGGPLGYQKILWIPAGALRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISS
Molecular weight 15.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp481-Ser601
Aliases /Synonyms ADAMTSL4, ADAMTS-like protein 4, ADAMTSL-4, TSRC1, Thrombospondin repeat-containing protein 1
Reference ARO-P11396
Note For research use only.
Molecular Constructor
Asp481–Ser601

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various research and clinical applications. One such protein is the Recombinant Human ADAMTSL4 Protein, which has gained significant attention due to its unique structure and diverse functions. In this article, we will explore the structure, activity, and applications of this protein in detail.

Structure of Recombinant Human ADAMTSL4 Protein

The Recombinant Human ADAMTSL4 Protein, also known as ADAMTS-like protein 4, is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. It is encoded by the ADAMTSL4 gene located on chromosome 1q21.2. This protein consists of 1,450 amino acids and has a molecular weight of approximately 160 kDa.

The primary structure of ADAMTSL4 protein contains several conserved domains, including a signal peptide, a propeptide, a metalloproteinase domain, a disintegrin-like domain, a thrombospondin type-1 (TSP1) motif, and a cysteine-rich domain. These domains are responsible for the diverse functions of this protein.

The crystal structure of the Recombinant Human ADAMTSL4 Protein has been determined, revealing a unique architecture with a central metalloproteinase domain surrounded by the disintegrin-like and TSP1 domains. This structure allows the protein to interact with various extracellular matrix components and regulate their functions.

Activity of Recombinant Human ADAMTSL4 Protein

The primary function of ADAMTSL4 protein is to regulate the formation and maintenance of extracellular matrix (ECM). It achieves this by interacting with various ECM components, such as fibrillin-1, fibronectin, and collagen, through its different domains.

The metalloproteinase domain of ADAMTSL4 protein has been shown to have proteolytic activity, which is essential for ECM remodeling. It cleaves fibrillin-1, a major component of elastic fibers, and regulates its assembly and stability. This activity is crucial for the development and maintenance of tissues, such as the skin, lungs, and blood vessels.

The disintegrin-like domain of ADAMTSL4 protein has been found to interact with integrins, a family of cell adhesion receptors, and modulate their signaling pathways. This interaction plays a crucial role in cell adhesion, migration, and proliferation, which are essential processes during tissue development and wound healing.

The TSP1 motif of ADAMTSL4 protein has been shown to bind to heparin and heparan sulfate, two glycosaminoglycans present in the ECM. This interaction is crucial for the regulation of ECM assembly and stability, as well as cell signaling and migration.

Application of Recombinant Human ADAMTSL4 Protein

The unique structure and diverse functions of the Recombinant Human ADAMTSL4 Protein make it a valuable tool in various research and clinical applications. One of the major applications of this protein is in the study of ECM-related diseases, such as Marfan syndrome, a connective tissue disorder caused by mutations in the fibrillin-1 gene. ADAMTSL4 protein can be used to investigate the role of ECM remodeling in the development of this disorder and potentially develop therapeutic interventions.

In addition, the proteolytic activity of ADAMTSL4 protein makes it a potential target for drug development. Inhibitors of this protein could be used to treat diseases associated with abnormal ECM remodeling, such as fibrosis and cancer.

Furthermore, the interaction of ADAMTSL4 protein with integr

Recombinant Human ADAMTSL4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ADAMTSL4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products