Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EXOG Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2C4
Molecular weight:
27.21 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Thr78–Thr298
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EXOG Protein, N-His

Product name ARO-P11395-100
Uniprot ID Q9Y2C4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDT
Molecular weight 27.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr78-Thr298
Aliases /Synonyms ENDOGL2, Endo G-like 1, EXOG, Nuclease EXOG, mitochondrial, ENGL, Endonuclease G-like 1, ENDOGL1
Reference ARO-P11395
Note For research use only.
Molecular Constructor
Thr78–Thr298
Product name ARO-P11395-1MG
Uniprot ID Q9Y2C4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDT
Molecular weight 27.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr78-Thr298
Aliases /Synonyms ENDOGL2, Endo G-like 1, EXOG, Nuclease EXOG, mitochondrial, ENGL, Endonuclease G-like 1, ENDOGL1
Reference ARO-P11395
Note For research use only.
Molecular Constructor
Thr78–Thr298
Product name ARO-P11395-50
Uniprot ID Q9Y2C4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNHALSYDQAKRVPRWVLEHISKSKIMGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDT
Molecular weight 27.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr78-Thr298
Aliases /Synonyms ENDOGL2, Endo G-like 1, EXOG, Nuclease EXOG, mitochondrial, ENGL, Endonuclease G-like 1, ENDOGL1
Reference ARO-P11395
Note For research use only.
Molecular Constructor
Thr78–Thr298

The Structure of Recombinant Human EXOG Protein

Recombinant Human EXOG Protein is a type of protein that is produced through genetic engineering techniques. It is a modified version of the naturally occurring EXOG protein, which is involved in DNA repair and maintenance. The recombinant protein is designed to have the same structure and function as the natural protein, but with enhanced properties for use in various applications.

The structure of Recombinant Human EXOG Protein is composed of 327 amino acids, with a molecular weight of approximately 37 kDa. It contains a conserved N-terminal catalytic domain and a C-terminal zinc finger domain. The catalytic domain is responsible for the protein’s enzymatic activity, while the zinc finger domain is involved in DNA binding and recognition.

The protein also has several post-translational modifications, including phosphorylation and acetylation, which can affect its activity and stability. These modifications can be controlled during the production of the recombinant protein, allowing for customization of its properties.

The Activity of Recombinant Human EXOG Protein

Recombinant Human EXOG Protein is a highly active enzyme that plays a crucial role in DNA repair and maintenance. Its main function is to remove damaged or mismatched nucleotides from the ends of DNA strands, preventing mutations and maintaining the integrity of the genome.

The protein has a high affinity for DNA and can recognize and bind to damaged sites. It then uses its catalytic domain to cleave the damaged nucleotides, resulting in a clean DNA end that can be repaired by other enzymes. This process is essential for maintaining the stability and accuracy of the genetic code.

In addition to its role in DNA repair, Recombinant Human EXOG Protein has also been found to have anti-inflammatory properties. It can inhibit the activity of certain enzymes involved in inflammation, thereby reducing the inflammatory response in various tissues. This makes it a potential therapeutic target for conditions such as arthritis and autoimmune diseases.

Applications of Recombinant Human EXOG Protein

Recombinant Human EXOG Protein has a wide range of potential applications in various fields, including pharmaceuticals, biotechnology, and research.

One of the main applications of this protein is in the development of novel therapeutics. Its ability to repair damaged DNA and regulate inflammation makes it a promising candidate for the treatment of genetic disorders, cancer, and inflammatory diseases. By modulating its activity and targeting specific tissues, Recombinant Human EXOG Protein can be used to develop targeted therapies with minimal side effects.

In biotechnology, Recombinant Human EXOG Protein can be used as a tool in DNA sequencing and cloning. Its high affinity for DNA and precise cleavage activity make it a valuable enzyme for manipulating DNA sequences in the laboratory. It can also be used in the production of recombinant proteins, as it can remove unwanted nucleotides from the ends of DNA fragments, allowing for the insertion of desired sequences.

In research, Recombinant Human EXOG Protein can be used to study the mechanisms of DNA repair and the role of this protein in various diseases. Its recombinant form allows for easier purification and manipulation, making it a valuable tool for understanding the structure and function of EXOG and its potential therapeutic applications.

In conclusion, Recombinant Human EXOG Protein is a versatile and highly active enzyme with a crucial role in DNA repair and maintenance. Its structure, activity, and potential applications make it a valuable tool for various industries and research fields. With further studies and advancements in genetic engineering techniques, this protein holds great potential for the development of novel therapeutics and biotechnological tools.

Recombinant Human EXOG Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EXOG Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products