Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CPEB1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZB8
Molecular weight:
30.80 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Cys311–Lys561
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CPEB1, N-His

Product name ARO-P13125-100
Uniprot ID Q9BZB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQK
Molecular weight 30.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys311-Lys561
Aliases /Synonyms CPEB, hCPEB-1, Cytoplasmic polyadenylation element-binding protein 1, CPE-binding protein 1, CPEB1, h-CPEB, CPE-BP1
Reference ARO-P13125
Note For research use only.
Molecular Constructor
Cys311–Lys561
Product name ARO-P13125-1MG
Uniprot ID Q9BZB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQK
Molecular weight 30.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys311-Lys561
Aliases /Synonyms CPEB, hCPEB-1, Cytoplasmic polyadenylation element-binding protein 1, CPE-binding protein 1, CPEB1, h-CPEB, CPE-BP1
Reference ARO-P13125
Note For research use only.
Molecular Constructor
Cys311–Lys561
Product name ARO-P13125-50
Uniprot ID Q9BZB8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQK
Molecular weight 30.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys311-Lys561
Aliases /Synonyms CPEB, hCPEB-1, Cytoplasmic polyadenylation element-binding protein 1, CPE-binding protein 1, CPEB1, h-CPEB, CPE-BP1
Reference ARO-P13125
Note For research use only.
Molecular Constructor
Cys311–Lys561

Recombinant Human CPEB1: Structure, Activity, and Applications

Introduction

Recombinant proteins are artificially produced proteins that are derived from genetic material through recombinant DNA technology. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and research. One such recombinant protein is Recombinant Human CPEB1, which has gained significant attention in recent years due to its unique structure and diverse functions.

Structure of Recombinant Human CPEB1

CPEB1, or cytoplasmic polyadenylation element-binding protein 1, is a highly conserved RNA-binding protein that plays a crucial role in regulating gene expression. It is composed of 627 amino acids and has a molecular weight of approximately 70 kDa. The structure of Recombinant Human CPEB1 consists of two RNA recognition motifs (RRMs) at the N-terminus and a zinc finger domain at the C-terminus.

The two RRMs are responsible for binding to specific RNA sequences, while the zinc finger domain is involved in protein-protein interactions. The N-terminal region of CPEB1 also contains a nuclear export signal, which allows the protein to shuttle between the nucleus and cytoplasm. This unique structure of Recombinant Human CPEB1 enables it to perform its diverse functions in regulating gene expression.

Activity of Recombinant Human CPEB1

The main function of CPEB1 is to regulate the translation of specific mRNAs by binding to their 3’ untranslated region (UTR). This binding leads to the elongation of the poly(A) tail, which is essential for mRNA stability and translation. CPEB1 also plays a role in mRNA localization, which is crucial for the proper functioning of cells.

Moreover, CPEB1 has been found to be involved in several other cellular processes, such as cell division, migration, and differentiation. It has also been linked to neurological disorders, as it plays a critical role in synaptic plasticity and memory formation.

Applications of Recombinant Human CPEB1

The unique structure and diverse functions of Recombinant Human CPEB1 make it a valuable tool in various applications. One of the major applications of this protein is in the field of biotechnology, where it is used in the production of recombinant proteins. CPEB1 has been shown to enhance the expression of recombinant proteins in mammalian cells, making it a useful tool for protein production.

Additionally, Recombinant Human CPEB1 has potential applications in gene therapy, as it can regulate the expression of therapeutic genes. It has also been studied as a potential target for cancer therapy, as it is involved in cell proliferation and migration.

Furthermore, CPEB1 has been used as an antigen in vaccine development. Studies have shown that CPEB1 can induce a strong immune response and can be used as a potential target for cancer immunotherapy.

Conclusion

In summary, Recombinant Human CPEB1 is a unique protein with a diverse range of functions. Its structure, activity, and applications make it a valuable tool in various fields, including biotechnology, gene therapy, and vaccine development. Further research on this protein may lead to new insights and potential therapeutic targets for various diseases.

Recombinant Human CPEB1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CPEB1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products