Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPA33, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99795
Molecular weight:
25.92 kDa

Original price was: €411.00.Current price is: €329.00.

100ug 20% OFF + 329 loyalty points
Ile22–Val235
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPA33, N-His

Product name ARO-P13145-100
Uniprot ID Q99795
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
Molecular weight 25.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Val235
Aliases /Synonyms Cell surface A33 antigen, GPA33, Glycoprotein A33
Reference ARO-P13145
Note For research use only.
Molecular Constructor
Ile22–Val235
Product name ARO-P13145-1MG
Uniprot ID Q99795
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
Molecular weight 25.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Val235
Aliases /Synonyms Cell surface A33 antigen, GPA33, Glycoprotein A33
Reference ARO-P13145
Note For research use only.
Molecular Constructor
Ile22–Val235
Product name ARO-P13145-50
Uniprot ID Q99795
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
Molecular weight 25.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile22-Val235
Aliases /Synonyms Cell surface A33 antigen, GPA33, Glycoprotein A33
Reference ARO-P13145
Note For research use only.
Molecular Constructor
Ile22–Val235

Recombinant Human GPA33: Structure, Activity, and Application

Recombinant Human GPA33, also known as glycoprotein A33, is a protein that plays a crucial role in cell adhesion and signaling pathways. It is a transmembrane glycoprotein that is expressed on the surface of epithelial cells in the gastrointestinal tract. Recombinant Human GPA33 is produced through genetic engineering techniques, making it a valuable tool in various scientific and medical applications.

Structure of Recombinant Human GPA33

Recombinant Human GPA33 is a type I transmembrane protein that is composed of 319 amino acids. It has a molecular weight of approximately 35 kDa and contains two extracellular domains, a transmembrane domain, and a cytoplasmic domain. The extracellular domains are responsible for the protein’s interaction with other molecules, while the transmembrane domain anchors the protein to the cell membrane. The cytoplasmic domain is involved in signaling pathways and helps regulate cell growth and differentiation.

Activity of Recombinant Human GPA33

The primary function of Recombinant Human GPA33 is to mediate cell-cell adhesion. It does this by binding to other molecules on the surface of neighboring cells, such as E-cadherin and β-catenin. This interaction helps maintain the integrity of the epithelial barrier in the gastrointestinal tract. Additionally, Recombinant Human GPA33 has been shown to play a role in cell signaling pathways, including the Wnt/β-catenin pathway, which is involved in cell proliferation and differentiation.

Application of Recombinant Human GPA33

Recombinant Human GPA33 has a wide range of applications in both scientific research and medical fields. One of its most significant uses is as a recombinant protein for studying cell adhesion and signaling pathways. Its ability to bind to other molecules and mediate cell-cell interactions makes it a valuable tool for understanding the mechanisms involved in these processes.

Moreover, Recombinant Human GPA33 has been studied as a potential target for cancer therapy. It is highly expressed in many types of cancer, including colorectal, pancreatic, and gastric cancer. Researchers have developed targeted therapies using antibodies or antibody-drug conjugates that specifically bind to Recombinant Human GPA33, leading to the destruction of cancer cells.

Furthermore, Recombinant Human GPA33 has been investigated as a potential diagnostic marker for cancer. Its overexpression in cancer cells makes it a promising biomarker for detecting and monitoring the progression of certain types of cancer. In addition, Recombinant Human GPA33 has been used in vaccine development, particularly for colorectal cancer, as it is a potential antigen that can stimulate an immune response against cancer cells.

Conclusion

In summary, Recombinant Human GPA33 is a transmembrane glycoprotein that plays a crucial role in cell adhesion and signaling pathways. Its structure, activity, and applications have been extensively studied, making it a valuable tool in scientific research and medical applications. Its potential as a cancer target and diagnostic marker highlights its importance in the development of new therapies and treatments for various diseases. As research on Recombinant Human GPA33 continues, it is likely that its significance and potential will only increase in the future.

Recombinant Human GPA33, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPA33, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products