Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human P2RX7, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99572
Molecular weight:
30.13 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Asp356–Tyr595
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human P2RX7, N-His

Product name ARO-P13158-100
Uniprot ID Q99572
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Molecular weight 30.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp356-Tyr595
Aliases /Synonyms P2RX7, Purinergic receptor, P2X purinoceptor 7, P2X7, P2Z receptor, ATP receptor
Reference ARO-P13158
Note For research use only.
Molecular Constructor
Asp356–Tyr595
Product name ARO-P13158-1MG
Uniprot ID Q99572
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Molecular weight 30.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp356-Tyr595
Aliases /Synonyms P2RX7, Purinergic receptor, P2X purinoceptor 7, P2X7, P2Z receptor, ATP receptor
Reference ARO-P13158
Note For research use only.
Molecular Constructor
Asp356–Tyr595
Product name ARO-P13158-50
Uniprot ID Q99572
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Molecular weight 30.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp356-Tyr595
Aliases /Synonyms P2RX7, Purinergic receptor, P2X purinoceptor 7, P2X7, P2Z receptor, ATP receptor
Reference ARO-P13158
Note For research use only.
Molecular Constructor
Asp356–Tyr595

Introduction to Recombinant Human P2RX7

Recombinant Human P2RX7 is a protein that plays a crucial role in the immune response and inflammation. It belongs to the P2X receptor family, which are ATP-gated ion channels found on the cell membrane. P2RX7 is a homotrimeric protein, meaning it is made up of three identical subunits. This protein is encoded by the P2RX7 gene and is expressed in various tissues, including immune cells, brain, and skin.

Structure of Recombinant Human P2RX7

The recombinant form of P2RX7 is produced through genetic engineering techniques in which the gene encoding for this protein is inserted into a suitable expression vector and then expressed in a host cell. The resulting protein is identical to the native form and contains 595 amino acids. Each subunit of P2RX7 consists of a large extracellular domain, two transmembrane domains, and a cytoplasmic domain.

The extracellular domain of P2RX7 is responsible for binding to its ligands, mainly ATP. It also contains a cysteine-rich region that is important for protein-protein interactions. The transmembrane domains form a channel through which ions, such as calcium and sodium, can pass. The cytoplasmic domain is involved in regulating the activity of the channel and signaling pathways.

Activity of Recombinant Human P2RX7

Recombinant Human P2RX7 is primarily known for its role in the immune system. It is expressed on various immune cells, including macrophages, dendritic cells, and T cells. Upon binding to its ligand, ATP, P2RX7 becomes activated and opens its channel, allowing the influx of ions. This results in the formation of pores on the cell membrane, which can lead to cell death.

In addition to its role in cell death, P2RX7 also plays a crucial role in the release of pro-inflammatory cytokines, such as interleukin-1 beta (IL-1β) and tumor necrosis factor alpha (TNF-α). These cytokines are important mediators of the immune response and are involved in various inflammatory diseases.

P2RX7 has also been shown to be involved in other physiological processes, such as pain perception, apoptosis, and cell proliferation. Its activity has been linked to various diseases, including autoimmune disorders, neurodegenerative diseases, and cancer.

Application of Recombinant Human P2RX7

Recombinant Human P2RX7 has been widely used in research to study its role in the immune response and inflammation. It is also used in drug discovery and development, as P2RX7 has been identified as a potential therapeutic target for various diseases.

One potential application of recombinant P2RX7 is in the treatment of inflammatory diseases. By targeting P2RX7, it is possible to modulate the release of pro-inflammatory cytokines and reduce inflammation. This has been demonstrated in various preclinical studies, and clinical trials are currently underway to evaluate the efficacy of P2RX7 inhibitors in inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease.

Recombinant Human P2RX7 has also been studied as a potential target for cancer therapy. P2RX7 has been shown to be involved in the growth and survival of cancer cells, and inhibiting its activity has been shown to reduce tumor growth in preclinical studies. Clinical trials are currently ongoing to evaluate the use of P2RX7 inhibitors in cancer treatment.

In addition, recombinant P2RX7 has been used in the development of diagnostic tools for various diseases. Its expression on immune cells makes it a potential biomarker for certain diseases, and researchers are exploring the use of P2RX7 as a diagnostic tool for conditions such as multiple sclerosis and lupus.

Conclusion

In summary, Recombinant Human P2RX7 is a homotrimeric protein that plays a crucial role in the immune response and inflammation.

Recombinant Human P2RX7, N-His

There are no reviews yet.

Be the first to review “Recombinant Human P2RX7, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products