Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MGLL, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99685
Molecular weight:
35.57 kDa

Original price was: €322.00.Current price is: €275.00.

100ug 15% OFF + 275 loyalty points
Met1–Pro303
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MGLL, N-His

Product name ARO-P13152-100
Uniprot ID Q99685
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro303
Aliases /Synonyms Lysophospholipase-like, MGLL, Monoacylglycerol lipase, Lysophospholipase homolog, MGL, Monoglyceride lipase, HU-K5, MAGL
Reference ARO-P13152
Note For research use only.
Molecular Constructor
Met1–Pro303
Product name ARO-P13152-1MG
Uniprot ID Q99685
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro303
Aliases /Synonyms Lysophospholipase-like, MGLL, Monoacylglycerol lipase, Lysophospholipase homolog, MGL, Monoglyceride lipase, HU-K5, MAGL
Reference ARO-P13152
Note For research use only.
Molecular Constructor
Met1–Pro303
Product name ARO-P13152-50
Uniprot ID Q99685
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
Molecular weight 35.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro303
Aliases /Synonyms Lysophospholipase-like, MGLL, Monoacylglycerol lipase, Lysophospholipase homolog, MGL, Monoglyceride lipase, HU-K5, MAGL
Reference ARO-P13152
Note For research use only.
Molecular Constructor
Met1–Pro303

Introduction to Recombinant Human MGLL

Recombinant Human MGLL, also known as monoglyceride lipase, is a protein that plays a crucial role in lipid metabolism. It is a member of the serine hydrolase family and is responsible for the hydrolysis of monoglycerides into free fatty acids and glycerol. This protein is highly conserved in mammals and is found in various tissues, including the brain, liver, and adipose tissue.

Structure of Recombinant Human MGLL

The recombinant form of human MGLL is produced through genetic engineering techniques, where the gene for MGLL is inserted into a suitable expression vector and then expressed in a host cell. The resulting protein is identical to the native human MGLL in terms of structure and function.

The crystal structure of recombinant human MGLL has been determined, revealing a globular protein with a central catalytic domain and two flanking domains. The catalytic domain contains the active site, which is responsible for the hydrolysis of monoglycerides. The flanking domains are important for the stability and regulation of the enzyme.

Activity of Recombinant Human MGLL

Recombinant Human MGLL is a key enzyme in the hydrolysis of monoglycerides, which are important intermediates in lipid metabolism. It catalyzes the conversion of monoglycerides into free fatty acids and glycerol, which can then be utilized for energy production or stored as triglycerides.

Studies have shown that MGLL is highly active in the brain, where it plays a crucial role in the regulation of endocannabinoid signaling. Endocannabinoids are lipid molecules that act as signaling molecules in the brain and are involved in various physiological processes, including pain sensation, appetite, and mood regulation. MGLL helps to maintain the proper levels of endocannabinoids by degrading them into inactive metabolites.

In addition to its role in lipid metabolism, MGLL has also been implicated in other physiological processes, such as inflammation and cancer. It has been shown to modulate the immune response by regulating the production of pro-inflammatory mediators. MGLL has also been found to be overexpressed in certain types of cancer, suggesting a potential role in tumor growth and progression.

Application of Recombinant Human MGLL

The availability of recombinant human MGLL has opened up new opportunities for research and drug development. Its role in lipid metabolism and endocannabinoid signaling makes it a potential target for the treatment of obesity, diabetes, and other metabolic disorders. Inhibitors of MGLL have been developed as potential therapeutics for these conditions, and the recombinant protein is a valuable tool for screening and testing these inhibitors.

Furthermore, the use of recombinant MGLL in research has helped to elucidate its role in various physiological processes and to better understand its potential as a therapeutic target. Recombinant MGLL has been used in studies to investigate its role in endocannabinoid signaling, inflammation, and cancer, providing valuable insights into these complex processes.

Conclusion

In summary, recombinant human MGLL is a key enzyme involved in lipid metabolism and endocannabinoid signaling. Its structure and activity are well characterized, and the availability of recombinant protein has greatly advanced research in this field. With its potential as a therapeutic target and its role in various physiological processes, recombinant human MGLL continues to be an important protein in both scientific research and drug development.

Recombinant Human MGLL, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MGLL, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products