Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q93050
Molecular weight:
22.48 kDa

Original price was: €308.00.Current price is: €275.00.

100ug 11% OFF + 275 loyalty points
Arg167–Arg241
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11720-100
Uniprot ID Q93050
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFR
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg167-Arg241
Aliases /Synonyms V-ATPase 116 kDa subunit a1, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, ATP6V0A1, V-type proton ATPase 116 kDa subunit a1, ATP6N1, Vacuolar proton pump subunit 1, VPP1, Vacuolar adenosine triphosphatase subunit Ac116, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, ATP6N1A
Reference ARO-P11720
Note For research use only.
Molecular Constructor
Arg167–Arg241
Product name ARO-P11720-1MG
Uniprot ID Q93050
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFR
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg167-Arg241
Aliases /Synonyms V-ATPase 116 kDa subunit a1, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, ATP6V0A1, V-type proton ATPase 116 kDa subunit a1, ATP6N1, Vacuolar proton pump subunit 1, VPP1, Vacuolar adenosine triphosphatase subunit Ac116, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, ATP6N1A
Reference ARO-P11720
Note For research use only.
Molecular Constructor
Arg167–Arg241
Product name ARO-P11720-50
Uniprot ID Q93050
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFR
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg167-Arg241
Aliases /Synonyms V-ATPase 116 kDa subunit a1, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, ATP6V0A1, V-type proton ATPase 116 kDa subunit a1, ATP6N1, Vacuolar proton pump subunit 1, VPP1, Vacuolar adenosine triphosphatase subunit Ac116, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, ATP6N1A
Reference ARO-P11720
Note For research use only.
Molecular Constructor
Arg167–Arg241

Introduction

Recombinant proteins are an essential tool in many fields of biological research and have a wide range of applications in medicine, biotechnology, and diagnostics. One such protein is the Recombinant Human ATP6V0A1 Protein, which plays a crucial role in cellular processes and has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human ATP6V0A1 Protein

The ATP6V0A1 gene encodes for the V-type proton ATPase subunit a1, which is a key component of the vacuolar H+ ATPase (V-ATPase) complex. This complex is responsible for maintaining the acidic environment within the cellular compartments, which is crucial for various cellular processes such as protein trafficking, receptor-mediated endocytosis, and lysosomal degradation.

The recombinant form of this protein is produced through genetic engineering techniques, where the gene is inserted into an expression vector and expressed in a host cell. The resulting protein has a molecular weight of approximately 100 kDa and is composed of two subunits – the transmembrane subunit (V0) and the cytoplasmic subunit (V1).

The V0 subunit contains six transmembrane domains and is responsible for the proton translocation across the membrane, while the V1 subunit has eight subunits and is responsible for ATP hydrolysis, which provides the energy for proton transport.

Activity of Recombinant Human ATP6V0A1 Protein

The recombinant human ATP6V0A1 protein has been extensively studied for its activity and function in cellular processes. It has been shown to be essential for the acidification of cellular compartments, which is crucial for maintaining the correct pH for various enzymatic reactions and protein functions.

In addition, this protein has been found to play a role in regulating the activity of lysosomal enzymes, which are involved in the degradation of cellular components. It also plays a role in the regulation of cell proliferation, differentiation, and apoptosis.

Furthermore, studies have shown that mutations in the ATP6V0A1 gene can lead to various diseases, such as osteopetrosis and renal tubular acidosis, highlighting the importance of this protein in maintaining cellular homeostasis.

Applications of Recombinant Human ATP6V0A1 Protein

The recombinant form of this protein has numerous potential applications in various fields of research and medicine. One of the primary applications is in drug discovery and development, where the protein can be used as a target for drug screening and development of therapeutics for diseases associated with V-ATPase dysfunction.

Additionally, the recombinant protein can also be used in diagnostic assays for diseases associated with mutations in the ATP6V0A1 gene. This can aid in early detection and treatment of these diseases.

Moreover, the recombinant protein can also be used in the production of vaccines as an antigen, as it has been shown to elicit a strong immune response in various studies. This can be beneficial in the development of vaccines against infectious diseases.

Conclusion

In conclusion, the Recombinant Human ATP6V0A1 Protein is a crucial component of the V-ATPase complex and has a wide range of applications in research and medicine. Its structure and activity have been extensively studied, and it has shown potential as a target for drug development, diagnostic assays, and vaccine production. Further research on this protein can lead to a better understanding of its role in cellular processes and its potential applications in various fields.

Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human ATP6V0A1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products