Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ANKRD27 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96NW4
Molecular weight:
28.99 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Met654–Ser902
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ANKRD27 Protein, N-His

Product name ARO-P11162-100
Uniprot ID Q96NW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
Molecular weight 28.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met654-Ser902
Aliases /Synonyms ANKRD27, Ankyrin repeat domain-containing protein 27, VPS9 domain-containing protein
Reference ARO-P11162
Note For research use only.
Molecular Constructor
Met654–Ser902
Product name ARO-P11162-1MG
Uniprot ID Q96NW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
Molecular weight 28.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met654-Ser902
Aliases /Synonyms ANKRD27, Ankyrin repeat domain-containing protein 27, VPS9 domain-containing protein
Reference ARO-P11162
Note For research use only.
Molecular Constructor
Met654–Ser902
Product name ARO-P11162-50
Uniprot ID Q96NW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
Molecular weight 28.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met654-Ser902
Aliases /Synonyms ANKRD27, Ankyrin repeat domain-containing protein 27, VPS9 domain-containing protein
Reference ARO-P11162
Note For research use only.
Molecular Constructor
Met654–Ser902

Introduction

Recombinant Human ANKRD27 Protein, also known as Ankyrin Repeat Domain 27, is a protein that plays a crucial role in various cellular processes. It is a member of the ankyrin repeat-containing protein family, which is characterized by multiple repeats of a 33-amino acid motif known as the ankyrin repeat. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure of Recombinant Human ANKRD27 Protein

The ANKRD27 protein is composed of 1,158 amino acids and has a molecular weight of approximately 130 kDa. It contains 13 ankyrin repeats, which are arranged in tandem and form a curved solenoid structure. These repeats are involved in protein-protein interactions and play a crucial role in the function of ANKRD27.

Activity of Recombinant Human ANKRD27 Protein

The ANKRD27 protein is primarily involved in cellular signaling and regulation. It interacts with various proteins, including transcription factors, cytoskeletal proteins, and enzymes, to regulate their activity. It has been shown to play a role in cell proliferation, differentiation, and apoptosis.

One of the key functions of ANKRD27 is its involvement in the Wnt signaling pathway. It interacts with the key signaling protein β-catenin and regulates its activity, which is essential for cell proliferation and development. ANKRD27 has also been shown to play a role in the regulation of the Notch signaling pathway, which is involved in cell differentiation and development.

Applications of Recombinant Human ANKRD27 Protein

Due to its important role in cellular processes, ANKRD27 has been studied extensively and has various potential applications. One of the most promising applications is in cancer research. ANKRD27 has been found to be overexpressed in several types of cancer, including breast, lung, and colorectal cancer. It has been suggested that ANKRD27 may serve as a biomarker for these cancers and could potentially be targeted for therapeutic purposes.

Moreover, ANKRD27 has also been implicated in the development of neurological disorders. It has been found to be involved in the regulation of neuronal differentiation and migration, and its dysfunction has been linked to disorders such as autism and schizophrenia. Further research on ANKRD27 could provide valuable insights into the pathogenesis of these disorders and potentially lead to the development of new treatments.

In addition, ANKRD27 has been studied for its role in muscle development and function. It has been found to interact with proteins involved in muscle contraction and has been suggested to play a role in the regulation of muscle mass. This makes ANKRD27 a potential target for the treatment of muscle wasting diseases such as muscular dystrophy.

Conclusion

In summary, Recombinant Human ANKRD27 Protein is a crucial protein involved in various cellular processes. Its structure, with 13 ankyrin repeats, allows it to interact with multiple proteins and regulate their activity. ANKRD27 has been implicated in cancer, neurological disorders, and muscle development, making it a promising target for research and potential therapeutic applications. Further studies on this protein could provide a better understanding of its role in these diseases and lead to the development of new treatments.

Recombinant Human ANKRD27 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ANKRD27 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products