Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BWT1
Molecular weight:
16.78 kDa

Original price was: €288.00.Current price is: €230.00.

50ug 20% OFF + 230 loyalty points
Thr246–Ala371
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA7 Protein, N-His

Product name ARO-P11164-100
Uniprot ID Q9BWT1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYLKSLKQEFEMQA
Molecular weight 16.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr246-Ala371
Aliases /Synonyms CDCA7, JPO1, Cell division cycle-associated protein 7, Protein JPO1
Reference ARO-P11164
Note For research use only.
Molecular Constructor
Thr246–Ala371
Product name ARO-P11164-1MG
Uniprot ID Q9BWT1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYLKSLKQEFEMQA
Molecular weight 16.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr246-Ala371
Aliases /Synonyms CDCA7, JPO1, Cell division cycle-associated protein 7, Protein JPO1
Reference ARO-P11164
Note For research use only.
Molecular Constructor
Thr246–Ala371
Product name ARO-P11164-50
Uniprot ID Q9BWT1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYLKSLKQEFEMQA
Molecular weight 16.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr246-Ala371
Aliases /Synonyms CDCA7, JPO1, Cell division cycle-associated protein 7, Protein JPO1
Reference ARO-P11164
Note For research use only.
Molecular Constructor
Thr246–Ala371

Introduction

Recombinant Human CDCA7 Protein, also known as Cell division cycle-associated protein 7, is a crucial protein involved in cell cycle regulation and chromatin remodeling. This protein is encoded by the CDCA7 gene and is highly conserved across different species, indicating its importance in cellular processes. In this article, we will discuss the structure, activity, and application of Recombinant Human CDCA7 Protein.

Structure of Recombinant Human CDCA7 Protein

The CDCA7 gene is located on chromosome 2 in humans and consists of 10 exons. The protein is composed of 480 amino acids and has a molecular weight of approximately 55 kDa. It contains a conserved N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain is responsible for binding to chromatin, while the central domain interacts with other proteins involved in cell cycle regulation. The C-terminal domain contains a nuclear localization signal, which helps in the localization of the protein to the nucleus.

Activity of Recombinant Human CDCA7 Protein

Recombinant Human CDCA7 Protein plays a crucial role in regulating the cell cycle by interacting with various proteins involved in cell division. It is also involved in chromatin remodeling, which is essential for gene expression and DNA repair. This protein has been found to be upregulated during the G1/S phase of the cell cycle, indicating its importance in the transition from G1 to S phase. CDCA7 has also been shown to interact with the retinoblastoma protein (Rb), a tumor suppressor protein, and regulate its activity. Furthermore, studies have shown that CDCA7 is involved in the maintenance of genomic stability and is essential for the proper functioning of DNA replication and repair.

Application of Recombinant Human CDCA7 Protein

Recombinant Human CDCA7 Protein has various applications in both research and clinical settings. One of the main applications of this protein is in the study of cell cycle regulation and chromatin remodeling. It can be used as a tool to understand the mechanisms involved in these processes and their dysregulation in diseases such as cancer. Additionally, CDCA7 has been identified as a potential therapeutic target for cancer treatment, as its overexpression has been observed in various types of cancer.

Furthermore, Recombinant Human CDCA7 Protein has been used in the development of diagnostic tests for cancer. Its overexpression in cancer cells makes it a potential biomarker for early detection and monitoring of cancer progression. CDCA7 has also been shown to be involved in drug resistance in cancer cells, making it a potential target for the development of new cancer therapies.

In addition to its role in cancer, Recombinant Human CDCA7 Protein has also been studied in other diseases such as neurodevelopmental disorders. Studies have shown that mutations in the CDCA7 gene can lead to intellectual disability and developmental delay. Therefore, this protein can be used as a diagnostic tool for these disorders and as a potential target for therapeutic interventions.

Conclusion

In summary, Recombinant Human CDCA7 Protein is a crucial protein involved in cell cycle regulation and chromatin remodeling. Its structure, activity, and applications have been extensively studied, and it has been identified as a potential therapeutic target for cancer and other diseases. Further research on this protein can provide valuable insights into its role in cellular processes and its potential as a diagnostic and therapeutic tool.

Recombinant Human CDCA7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CDCA7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products