Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TOP2B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q02880
Molecular weight:
35.24 kDa

Original price was: €355.00.Current price is: €275.00.

100ug 23% OFF + 275 loyalty points
Ser50–Asn336
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TOP2B Protein, N-His

Product name ARO-P11163-100
Uniprot ID Q02880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVN
Molecular weight 35.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Asn336
Aliases /Synonyms DNA topoisomerase 2-beta, TOP2B, DNA topoisomerase II, beta isozyme
Reference ARO-P11163
Note For research use only.
Molecular Constructor
Ser50–Asn336
Product name ARO-P11163-1MG
Uniprot ID Q02880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVN
Molecular weight 35.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Asn336
Aliases /Synonyms DNA topoisomerase 2-beta, TOP2B, DNA topoisomerase II, beta isozyme
Reference ARO-P11163
Note For research use only.
Molecular Constructor
Ser50–Asn336
Product name ARO-P11163-50
Uniprot ID Q02880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVERVYQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVN
Molecular weight 35.24 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Asn336
Aliases /Synonyms DNA topoisomerase 2-beta, TOP2B, DNA topoisomerase II, beta isozyme
Reference ARO-P11163
Note For research use only.
Molecular Constructor
Ser50–Asn336

Title: Introduction to Recombinant Human TOP2B Protein

Recombinant Human TOP2B Protein, also known as DNA topoisomerase II beta, is a key enzyme involved in DNA replication and transcription. This protein is encoded by the TOP2B gene and is a member of the topoisomerase family, which plays a crucial role in maintaining the integrity and stability of the genome. In this article, we will explore the structure, activity, and applications of Recombinant Human TOP2B Protein.

Title: Structure of Recombinant Human TOP2B Protein

Recombinant Human TOP2B Protein is a 170 kDa protein that consists of 1531 amino acids. It is composed of four functional domains: an N-terminal domain, a central core domain, a C-terminal domain, and a C-terminal acidic tail. The N-terminal domain contains the DNA binding region, while the central core domain is responsible for the catalytic activity of the enzyme. The C-terminal domain is involved in protein-protein interactions, and the C-terminal acidic tail is essential for the regulation of enzyme activity. The structure of Recombinant Human TOP2B Protein is highly conserved among different species, indicating its critical role in cellular processes.

Title: Activity of Recombinant Human TOP2B Protein

Recombinant Human TOP2B Protein is a type II topoisomerase, which means it is involved in the breaking and rejoining of double-stranded DNA. This enzyme is essential for DNA replication, transcription, and chromosome segregation. It works by creating a transient double-strand break in the DNA, allowing it to unwind and relieve the tension caused by the supercoiling of the DNA. This activity is crucial for the proper functioning and maintenance of the genome. Mutations in the TOP2B gene have been linked to various diseases, including cancer and developmental disorders, highlighting the importance of this protein in cellular processes.

Title: Applications of Recombinant Human TOP2B Protein

Recombinant Human TOP2B Protein has numerous applications in both research and therapeutic settings. It is widely used in the study of DNA replication, transcription, and chromosome dynamics. This protein has also been utilized in drug discovery and development, as it is a target for several anti-cancer drugs, such as etoposide and doxorubicin. These drugs work by inhibiting the activity of TOP2B, leading to the death of cancer cells. Recombinant Human TOP2B Protein is also used in the production of vaccines, as it can be used as an antigen to elicit an immune response against specific diseases.

Title: Production of Recombinant Human TOP2B Protein

Recombinant Human TOP2B Protein is produced using recombinant DNA technology, where the TOP2B gene is inserted into a suitable expression vector and then expressed in a host cell, such as E. coli or insect cells. The protein is then purified using various chromatography techniques to obtain a highly pure and active form. The availability of recombinant TOP2B Protein has greatly facilitated its use in research and therapeutic applications.

Title: Conclusion

In conclusion, Recombinant Human TOP2B Protein is a crucial enzyme involved in DNA replication and transcription. Its structure and activity make it an essential player in maintaining the integrity and stability of the genome. This protein has various applications in research and therapeutics, and its production using recombinant DNA technology has greatly enhanced its availability and use. Further research on this protein may lead to a better understanding of its role in disease processes and potential new therapeutic targets.

Recombinant Human TOP2B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TOP2B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products