Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pritoxaximab Biosimilar – Anti-shiga toxin type 1 B subunit mAb – Research Grade

  • PX-TA1318-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

Product name Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade
Uniprot ID Q47641
Source CAS 1351470-16-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MKKILLIAASLSFFSASVLAAPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pritoxaximab,Shigamabs-(drug name for the combination of pritoxaximab and setoxaximab),caStx1,shiga toxin type 1 B subunit,anti-shiga toxin type 1 B subunit
Reference PX-TA1318
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade
Uniprot ID Q47641
Source CAS 1351470-16-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MKKILLIAASLSFFSASVLAAPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pritoxaximab,Shigamabs-(drug name for the combination of pritoxaximab and setoxaximab),caStx1,shiga toxin type 1 B subunit,anti-shiga toxin type 1 B subunit
Reference PX-TA1318
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1318-50
Uniprot ID Q47641
Source CAS 1351470-16-0
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MKKILLIAASLSFFSASVLAAPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pritoxaximab,Shigamabs-(drug name for the combination of pritoxaximab and setoxaximab),caStx1,shiga toxin type 1 B subunit,anti-shiga toxin type 1 B subunit
Reference PX-TA1318
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-shiga toxin type 1 B subunit[Escherichia coli] (Pritoxaximab) Monoclonal Antibody

Pritoxaximab has been investigated for the prevention and treatment of Shiga-like toxin-producing Escherichia coli(STEC) or E. coli serotype O121 infection.

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade in ELISA Assay

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade in ELISA Assay

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

SDS-PAGE for Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Pritoxaximab Biosimilar - Anti-shiga toxin type 1 B subunit mAb - Research Grade

There are no reviews yet.

Be the first to review “Pritoxaximab Biosimilar – Anti-shiga toxin type 1 B subunit mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products