Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Polatuzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Polatuzumab ELISA Kit

Polatuzumab ELISA Kit

Product name Polatuzumab ELISA Kit
Uniprot ID P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX229
Note For research use only.
Sample type Plasma, Serum
Target Polatuzumab
Immunogen Polatuzumab

The Structure and Function of Polatuzumab ELISA Kit: An Essential Tool for Antibody Research

Introduction

Polatuzumab is a monoclonal antibody that has gained significant attention in recent years due to its potential as a therapeutic target for various diseases, including cancer. To better understand the role of this antibody and its potential applications, the development of a Polatuzumab ELISA Kit has been crucial. This kit allows for the accurate and efficient detection of Polatuzumab in various samples, providing valuable insights into its structure, activity, and potential therapeutic applications.

Structure of Polatuzumab

Polatuzumab is a humanized monoclonal antibody that targets CD79b, a protein that is highly expressed in B-cell malignancies. The antibody is composed of two heavy chains and two light chains, each with a unique amino acid sequence. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region. These regions are responsible for the specificity of Polatuzumab and its ability to bind to CD79b.

The structure of Polatuzumab is also crucial for its function. The antibody has a Y-shaped structure, with the two heavy chains forming the arms and the two light chains forming the base. This structure allows Polatuzumab to bind to CD79b with high affinity and specificity, making it an effective therapeutic target.

Activity of Polatuzumab

The primary activity of Polatuzumab is its ability to bind to CD79b, a protein that is overexpressed in B-cell malignancies. By binding to CD79b, Polatuzumab can inhibit the growth and survival of cancer cells, making it a promising therapeutic agent for diseases such as non-Hodgkin lymphoma and chronic lymphocytic leukemia.

In addition to its direct binding activity, Polatuzumab also has the ability to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These mechanisms involve the activation of immune cells, such as natural killer cells and macrophages, to target and destroy cancer cells that have been bound by Polatuzumab. This dual mechanism of action makes Polatuzumab a potent and effective therapeutic agent.

Application of Polatuzumab ELISA Kit

The development of a Polatuzumab ELISA Kit has been crucial for the research and development of this antibody. This kit allows for the accurate and efficient detection of Polatuzumab in various samples, including serum, plasma, and cell lysates. It provides researchers with valuable insights into the pharmacokinetics and pharmacodynamics of Polatuzumab, as well as its potential as a therapeutic agent.

The Polatuzumab ELISA Kit has also been used in clinical trials to monitor the levels of Polatuzumab in patients receiving treatment. This allows for the optimization of dosing and the evaluation of the efficacy of the antibody in different patient populations. Furthermore, the kit has been used in preclinical studies to assess the biodistribution and tissue penetration of Polatuzumab, providing valuable information for the development of new treatment strategies.

Conclusion

The development of a Polatuzumab ELISA Kit has been a significant advancement in the field of antibody research. It has allowed for a better understanding of the structure and function of Polatuzumab, as well as its potential as a therapeutic target. With its high specificity and dual mechanism of action, Polatuzumab shows great promise as a treatment for various diseases, and the Polatuzumab ELISA Kit will continue to play a crucial role in its development and application.

Polatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Polatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products