Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pasotuxizumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Pasotuxizumab ELISA Kit

Pasotuxizumab ELISA Kit

Product name Pasotuxizumab ELISA Kit
Uniprot ID Q04609 & P07766
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX238
Note For research use only.
Sample type Plasma, Serum
Target Pasotuxizumab
Immunogen Pasotuxizumab

Pasotuxizumab ELISA Kit: A Reliable Tool for Antibody Detection and

Therapeutic Target Identification Introduction

Pasotuxizumab is a monoclonal antibody that has gained significant attention in the field of cancer therapy due to its potential as a therapeutic target. This antibody specifically targets the human programmed death-ligand 1 (PD-L1) protein, which is overexpressed in many types of cancers and plays a crucial role in tumor immune evasion. To facilitate the detection and quantification of Pasotuxizumab in biological samples, a highly sensitive and specific ELISA kit has been developed. In this article, we will provide a detailed description of the structure, activity, and application of the Pasotuxizumab ELISA kit.

Structure of Pasotuxizumab

Pasotuxizumab is a fully humanized IgG1 monoclonal antibody that is composed of two heavy chains and two light chains, each containing a variable and a constant region. The variable regions of the heavy and light chains are responsible for antigen recognition and binding, while the constant regions determine the effector functions of the antibody. Pasotuxizumab is produced through recombinant DNA technology using Chinese hamster ovary (CHO) cells, ensuring high purity and consistency.

Activity of Pasotuxizumab

Pasotuxizumab binds specifically to the PD-L1 protein and blocks its interaction with the programmed cell death protein 1 (PD-1) receptor on T cells. This inhibits the PD-L1-mediated suppression of T cell activation and allows for an enhanced immune response against tumor cells. Pasotuxizumab has also been shown to induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), leading to the destruction of PD-L1-expressing cancer cells.

Pasotuxizumab ELISA Kit

The Pasotuxizumab ELISA kit is a highly sensitive and specific tool for the detection and quantification of Pasotuxizumab in various biological samples, such as serum, plasma, and cell culture supernatants. The kit utilizes the sandwich ELISA technique, where the capture antibody is coated on the microplate wells and the detection antibody is conjugated to an enzyme for signal amplification. The Pasotuxizumab present in the sample binds to the capture antibody, and the detection antibody-enzyme conjugate produces a colorimetric signal that is directly proportional to the amount of Pasotuxizumab present in the sample.

Application of Pasotuxizumab ELISA Kit

The Pasotuxizumab ELISA kit has a wide range of applications in both research and clinical settings. In research, it can be used to monitor the levels of Pasotuxizumab in biological samples during preclinical studies, pharmacokinetic and pharmacodynamic studies, and clinical trials. It can also be used to evaluate the immune response to Pasotuxizumab therapy and to assess the potential for drug resistance. In clinical settings, the kit can aid in the diagnosis and monitoring of PD-L1-expressing cancers, such as non-small cell lung cancer, melanoma, and bladder cancer. It can also be used to determine the optimal dosing and treatment regimen for Pasotuxizumab therapy.

Conclusion

In summary, the Pasotuxizumab ELISA kit is a reliable and convenient tool for the detection and quantification of Pasotuxizumab in various biological samples. Its high sensitivity and specificity make it a valuable asset in both research and clinical settings for studying the structure, activity, and application of this promising therapeutic antibody. With the growing interest in Pasotuxizumab as a potential cancer therapy, the Pasotuxizumab ELISA kit will continue to play a crucial role in advancing our understanding of this antibody and its potential as a therapeutic target.

Pasotuxizumab ELISA Kit

There are no reviews yet.

Be the first to review “Pasotuxizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products