Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iladatuzumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Iladatuzumab ELISA Kit

Iladatuzumab ELISA Kit

Product name Iladatuzumab ELISA Kit
Uniprot ID P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX228
Note For research use only.
Sample type Plasma, Serum
Target Iladatuzumab
Immunogen Iladatuzumab

Introduction

The Iladatuzumab ELISA Kit is a powerful tool for detecting and quantifying the presence of Iladatuzumab, a monoclonal antibody used as a therapeutic target in various diseases. This kit is designed to provide accurate and sensitive measurements of Iladatuzumab levels in biological samples, making it an essential tool for researchers and clinicians in the field of immunology and drug development.

What is Iladatuzumab?

Iladatuzumab is a monoclonal antibody that targets the CD22 protein, which is expressed on the surface of B-cells. It belongs to the class of immunotherapeutic drugs known as monoclonal antibodies, which are designed to specifically bind to a particular target and elicit a therapeutic response. Iladatuzumab is currently being investigated for its potential use in the treatment of B-cell malignancies, such as non-Hodgkin’s lymphoma and chronic lymphocytic leukemia.

Structure of Iladatuzumab

Iladatuzumab is a chimeric antibody, meaning that it is composed of both human and non-human components. It consists of two heavy chains and two light chains, which are connected by disulfide bonds. The variable regions of the antibody, responsible for binding to the CD22 protein, are derived from a mouse antibody, while the constant regions are humanized to minimize potential immunogenicity. This unique structure allows Iladatuzumab to specifically target CD22 on B-cells without triggering an immune response.

Mechanism of Action

Iladatuzumab works by binding to the CD22 protein on the surface of B-cells, which leads to the activation of various signaling pathways. This ultimately results in the destruction of the B-cell, either through direct cell death or by triggering the body’s immune system to attack the cell. This mechanism of action makes Iladatuzumab an attractive therapeutic target for diseases that involve abnormal B-cell proliferation, such as B-cell malignancies.

Application of Iladatuzumab ELISA Kit

The Iladatuzumab ELISA Kit is specifically designed for the quantitative measurement of Iladatuzumab levels in various biological samples, including serum, plasma, and cell culture supernatants. This kit utilizes the sandwich ELISA method, which involves the use of two specific antibodies – one coated on the plate and the other conjugated with an enzyme – to capture and detect Iladatuzumab in the sample. The level of Iladatuzumab in the sample is directly proportional to the amount of signal produced, which can be measured using a spectrophotometer. This allows for accurate and sensitive detection of Iladatuzumab, with a detection limit of 0.1 ng/mL.

Advantages of Iladatuzumab ELISA Kit

The Iladatuzumab ELISA Kit offers several advantages over other methods of Iladatuzumab detection. Firstly, it is highly specific, as it only detects Iladatuzumab and not other antibodies or proteins. This eliminates the risk of false positives and ensures accurate results. Additionally, the kit is simple and easy to use, with a short incubation time of only 2 hours. It also has a wide dynamic range, allowing for the detection of both high and low levels of Iladatuzumab. Furthermore, the kit is cost-effective and can be used for high-throughput screening of multiple samples simultaneously.

Conclusion

In summary, the Iladatuzumab ELISA Kit is a valuable tool for the detection and quantification of Iladatuzumab, a monoclonal antibody used as a therapeutic target in various diseases. Its high specificity, sensitivity, and ease of use make it an essential kit for researchers and clinicians studying the

Iladatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Iladatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products