Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Polatuzumab Biosimilar – Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb – Research Grade

  • PX-TA1317-50
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: €102.00.Current price is: €84.00.

50ug 18% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade

Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1317-50
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade
Uniprot ID P40259
Source DrugBank DB12240
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Polatuzumab,,CD79B(CD79b, B29, IGB, Ig-beta),anti-CD79B(CD79b, B29, IGB, Ig-beta)
Reference PX-TA1317
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

General information on Anti-CD79B(CD79b, B29, IGB, Ig-beta)[Homo sapiens] (Polatuzumab) Monoclonal Antibody

Polatuzumab is a humanized IgG1, kappa antibody targetting human CD79B. This antigen is required in the initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR).

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Immobilized Human CD79β/CD79B recombinant protein (cat. No.PX-P6276) at 0.5µg/mL (100µL/well) can bind to Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb (cat. No.PX-TA1317) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb - Research Grade

There are no reviews yet.

Be the first to review “Polatuzumab Biosimilar – Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products