Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Patecibart Biosimilar – Anti-Endothelin-1 receptor mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade

Product name Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade
Uniprot ID P25101
Source CAS: 2642374-04-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Endothelin-1 receptor, ETA, ET-A, ETRA, Endothelin receptor type A, EDNRA, hET-AR, ETA-R
Reference PX-TA1962
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade
Uniprot ID P25101
Source CAS: 2642374-04-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Endothelin-1 receptor, ETA, ET-A, ETRA, Endothelin receptor type A, EDNRA, hET-AR, ETA-R
Reference PX-TA1962
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1962-50
Uniprot ID P25101
Source CAS: 2642374-04-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Endothelin-1 receptor, ETA, ET-A, ETRA, Endothelin receptor type A, EDNRA, hET-AR, ETA-R
Reference PX-TA1962
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Patecibart Biosimilar – Anti-Endothelin-1 receptor mAb – Research Grade

Patecibart Biosimilar is a monoclonal antibody (mAb) that specifically targets the endothelin-1 receptor (ET-1R). It is a research grade biosimilar of the original Patecibart, a therapeutic antibody used for the treatment of pulmonary arterial hypertension (PAH). This biosimilar is designed to mimic the structure and function of the original Patecibart, providing researchers with a reliable and cost-effective tool for studying the role of ET-1R in various disease models.

Structure and Activity

Patecibart Biosimilar is a humanized IgG1 kappa monoclonal antibody, composed of two heavy chains and two light chains. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL). The variable domains are responsible for binding to the ET-1R, while the constant domains provide stability and effector functions.

Patecibart Biosimilar binds to the extracellular domain of the ET-1R with high affinity and specificity. This receptor is expressed on the surface of various cell types, including endothelial cells, smooth muscle cells, and fibroblasts. ET-1R is known to play a crucial role in regulating vascular tone, cell proliferation, and inflammation, making it a promising therapeutic target for various diseases.

By binding to the ET-1R, Patecibart Biosimilar blocks the binding of its natural ligand, endothelin-1. This prevents the activation of downstream signaling pathways, leading to vasodilation, inhibition of cell proliferation, and reduction of inflammation. This mechanism of action is similar to the original Patecibart, making Patecibart Biosimilar a reliable tool for studying the effects of ET-1R inhibition.

Applications

Patecibart Biosimilar has a wide range of applications in research, particularly in the fields of cardiovascular and pulmonary diseases. Its ability to specifically target the ET-1R makes it a valuable tool for studying the role of this receptor in various disease models.

One of the primary applications of Patecibart Biosimilar is in the study of PAH. This disease is characterized by high levels of ET-1 and increased ET-1R expression, leading to vasoconstriction and pulmonary vascular remodeling. By blocking the ET-1R, Patecibart Biosimilar can improve pulmonary blood flow and reduce pulmonary vascular resistance, making it a potential therapeutic option for PAH.

Additionally, Patecibart Biosimilar can also be used in studies of other cardiovascular diseases, such as hypertension and atherosclerosis. The ET-1R has been implicated in the development and progression of these diseases, and Patecibart Biosimilar can help researchers better understand their underlying mechanisms.

Furthermore, Patecibart Biosimilar has potential applications in other fields, such as cancer and inflammatory diseases. The ET-1R has been found to play a role in tumor growth and metastasis, and Patecibart Biosimilar could potentially inhibit these processes. It can also be used to study the role of ET-1R in inflammatory diseases, such as rheumatoid arthritis and psoriasis.

Conclusion

In summary, Patecibart Biosimilar is a research grade biosimilar of the original Patecibart, a therapeutic antibody used for the treatment of PAH. It specifically targets the ET-1R and has a similar structure and mechanism of action as the original Patecibart. With its high specificity and affinity for the ET-1R, Patecibart Biosimilar has a wide range of applications in research, particularly in the fields of cardiovascular and pulmonary diseases. Its availability as a biosimilar provides researchers with a cost-effective tool for studying the role of ET-1R in various

SDS-PAGE for Research Grade Patecibart

SDS-PAGE for Research Grade Patecibart

Research Grade Patecibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Patecibart Biosimilar - Anti-Endothelin-1 receptor mAb - Research Grade

There are no reviews yet.

Be the first to review “Patecibart Biosimilar – Anti-Endothelin-1 receptor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products