Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gremubamab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Gremubamab ELISA Kit

Gremubamab ELISA Kit

Product name Gremubamab ELISA Kit
Uniprot ID O30527
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX291
Note For research use only.
Sample type Plasma, Serum
Target Gremubamab
Immunogen Gremubamab

Introduction to Gremubamab ELISA Kit

Gremubamab, also known as OMP-21M18, is a humanized monoclonal antibody that specifically targets the protein glycoprotein NMB (GPNMB). GPNMB is a transmembrane protein that is overexpressed in various types of cancer, making it a promising therapeutic target for cancer treatment. The Gremubamab ELISA Kit is a highly sensitive and specific tool that allows for the detection and quantification of GPNMB levels in various biological samples. In this article, we will discuss the structure, activity, and applications of the Gremubamab ELISA Kit.

Structure of Gremubamab ELISA Kit

The Gremubamab ELISA Kit is a sandwich enzyme-linked immunosorbent assay (ELISA) that utilizes a pair of monoclonal antibodies specific to GPNMB. The capture antibody is coated on the surface of a microplate, while the detection antibody is labeled with an enzyme, such as horseradish peroxidase (HRP). The microplate is then incubated with the sample containing GPNMB, allowing for the formation of a sandwich complex between the capture and detection antibodies and the target protein. The amount of GPNMB in the sample is directly proportional to the signal generated by the enzyme, which can be measured using a spectrophotometer.

Activity of Gremubamab ELISA Kit

The Gremubamab ELISA Kit has a high sensitivity and specificity, with a detection limit of 0.04 ng/mL. This allows for the accurate quantification of GPNMB levels in various biological samples, including serum, plasma, and cell culture supernatant. The kit also has a wide dynamic range of 0.1-10 ng/mL, making it suitable for both low and high concentration samples. The assay can be completed in 3 hours, making it a convenient and efficient tool for researchers.

Applications of Gremubamab ELISA Kit

The Gremubamab ELISA Kit has various applications in cancer research and drug development. One of its main uses is in the detection and monitoring of GPNMB levels in cancer patients. GPNMB is overexpressed in various types of cancer, including breast, lung, and prostate cancer, and has been associated with tumor progression and poor prognosis. The Gremubamab ELISA Kit can be used to measure GPNMB levels in patient samples, providing valuable information for diagnosis, prognosis, and treatment response monitoring.

Additionally, the Gremubamab ELISA Kit can be used to evaluate the efficacy of GPNMB-targeted therapies. Gremubamab is currently being investigated as a potential therapeutic agent for cancer treatment. The ELISA Kit can be used to measure GPNMB levels in preclinical and clinical studies, providing insights into the mechanism of action and effectiveness of Gremubamab as a therapeutic agent.

Furthermore, the Gremubamab ELISA Kit can be used in basic research to study the role of GPNMB in cancer development and progression. By measuring GPNMB levels in different cell lines and tissues, researchers can gain a better understanding of the function of GPNMB and its potential as a therapeutic target.

Conclusion

In summary, the Gremubamab ELISA Kit is a valuable tool for the detection and quantification of GPNMB levels in various biological samples. Its high sensitivity, specificity, and wide dynamic range make it suitable for a range of applications in cancer research and drug development. With the increasing interest in GPNMB as a therapeutic target, the Gremubamab ELISA Kit will continue to play an important role in advancing our understanding and treatment of cancer.

Gremubamab ELISA Kit

There are no reviews yet.

Be the first to review “Gremubamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products