Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oxelumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Oxelumab ELISA Kit

Oxelumab ELISA Kit

Product name Oxelumab ELISA Kit
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX210
Note For research use only.
Sample type Plasma, Serum
Target Oxelumab
Immunogen Oxelumab

Introduction

Oxelumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of oxelumab, a monoclonal antibody, in biological samples. This kit is designed for research purposes and is not intended for diagnostic or therapeutic use.

Structure of Oxelumab

Oxelumab is a fully humanized monoclonal antibody that specifically binds to the interleukin-6 receptor (IL-6R). It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions of oxelumab are responsible for its high specificity and affinity towards IL-6R.

Activity of Oxelumab

IL-6R is a transmembrane protein that is expressed on various cell types, including immune cells, hepatocytes, and endothelial cells. It plays a crucial role in the immune response and inflammation by binding to interleukin-6 (IL-6), a pro-inflammatory cytokine. IL-6R signaling has been implicated in various diseases, such as rheumatoid arthritis, multiple myeloma, and Castleman’s disease.

Oxelumab inhibits IL-6R signaling by binding to the receptor and preventing IL-6 from binding, thereby blocking downstream signaling pathways. This leads to a decrease in the production of pro-inflammatory cytokines and a reduction in inflammation.

Application of Oxelumab ELISA Kit

The Oxelumab ELISA Kit has a wide range of applications in both research and clinical settings. It is primarily used for the detection and quantification of oxelumab levels in biological samples, such as serum, plasma, and cell culture supernatants. This allows for the monitoring of oxelumab levels in patients receiving treatment with the antibody.

In addition, the kit can also be used to measure the levels of free and bound oxelumab, providing valuable information on the pharmacokinetics of the antibody. This is particularly useful in drug development and clinical trials to determine the optimal dosage and dosing frequency of oxelumab.

Furthermore, the Oxelumab ELISA Kit can also be used to study the expression and function of IL-6R in various diseases. By measuring oxelumab levels in different patient populations, researchers can gain insights into the role of IL-6R signaling in the pathogenesis of diseases and potentially identify new therapeutic targets.

Conclusion

In summary, the Oxelumab ELISA Kit is a valuable tool for the detection and quantification of oxelumab in biological samples. Its high sensitivity and specificity make it an ideal choice for monitoring oxelumab levels in patients and studying the role of IL-6R signaling in diseases. With its wide range of applications, this kit is an essential tool for researchers and clinicians working in the field of immunology and inflammatory diseases.

Oxelumab ELISA Kit

There are no reviews yet.

Be the first to review “Oxelumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products