Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD20/MS4A1 recombinant protein

  • PX-P6274
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P11836
Molecular weight:
19.58 kDa

329.00

100ug + 329 loyalty points
His Trx Tags Ile143–Ser188
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD20/MS4A1 recombinant protein

Product name Human CD20/MS4A1 recombinant protein
Uniprot ID P11836
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence ISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS
Molecular weight 19.58 kDa
Protein delivered with Tag? N-Terminal His & N-Terminal Trx Tags
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile143-Ser188
Aliases /Synonyms B-lymphocyte surface antigen B1, Membrane-spanning 4-domains subfamily A member 1, MS4A1, Leukocyte surface antigen Leu-16, B-lymphocyte antigen CD20, Bp35, CD20
Reference PX-P6274
Note For research use only.
Molecular Constructor
His Trx Tags Ile143–Ser188

General information on Human CD20/MS4A1 recombinant protein

Structure of Human CD20/MS4A1 Recombinant Protein

The human CD20/MS4A1 recombinant protein is a type I membrane protein composed of a single extracellular loop, a single transmembrane domain, and a cytoplasmic tail. It is expressed on the surface of B-cells and is involved in B-cell activation and proliferation.

Activity of Human CD20/MS4A1 Recombinant Protein

The activity of the human CD20/MS4A1 recombinant protein is mediated by its interaction with other proteins, such as CD19 and CD21, which are involved in B-cell activation and proliferation. The CD20/MS4A1 protein is also involved in the regulation of B-cell differentiation and maturation.

Application of Human CD20/MS4A1 Recombinant Protein

The human CD20/MS4A1 recombinant protein is a promising target for the development of antibody-drug conjugates for the treatment of B-cell malignancies. Antibodies targeting the CD20/MS4A1 protein have been successfully used in clinical trials, demonstrating their potential as an effective treatment for various B-cell malignancies.

Ocrelizumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Ocrelizumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind to Ocrelizumab Biosimilar - Anti-MS4A1, CD20 mAb (cat. No.PX-TA1162) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Ibritumomab Biosimilar - Anti-MS4A1(CD20,MS4A-1) mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Ibritumomab Biosimilar - Anti-MS4A1(CD20,MS4A-1) mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind Ibritumomab Biosimilar - Anti-MS4A1(CD20,MS4A-1) mAb - Research Grade (cat. No.PX-TA1620) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 279.7M.

Obinutuzumab Biosimilar - Anti-MS4A1, CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Obinutuzumab Biosimilar - Anti-MS4A1, CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind Obinutuzumab Biosimilar - Anti-MS4A1, CD20 mAb - Research Grade (cat. No.PX-TA1172) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 134.2M.

Mosunetuzumab Biosimilar - Anti-CD3E; MS4A1; CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Mosunetuzumab Biosimilar - Anti-CD3E; MS4A1; CD20 mAb - Research Grade binds to Human CD20/MS4A1 recombinant protein in ELISA assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind Mosunetuzumab Biosimilar - Anti-CD3E; MS4A1; CD20 mAb - Research Grade (cat. No.PX-TA1482) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 472.8M.

Ocaratuzumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Ocaratuzumab Biosimilar - Anti-MS4A1, CD20 mAb binds to Human CD20/MS4A1 recombinant protein in indirect ELISA Assay

Immobilized Human CD20/MS4A1 recombinant protein (cat. No.PX-P6274) at 0.5µg/mL (100µL/well) can bind to Ocaratuzumab Biosimilar - Anti-MS4A1, CD20 mAb (cat. No.PX-TA1298) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human CD20/MS4A1 recombinant protein

There are no reviews yet.

Be the first to review “Human CD20/MS4A1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products