Name: ETS homologous factor (Ehf )
SKU: PX-P4620-10
Availability: InStock

Product name	ETS homologous factor (Ehf )
Uniprot ID	O70273
Uniprot link	https://www.uniprot.org/uniprot/O70273
Origin species	House Mouse
Expression system	Prokaryotic expression
Sequence	MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNLEHHHHHH
Molecular weight	14.97kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met1-Asn127
Protein Accession	O70273
Spec:Entrez GeneID	13661
Spec:NCBI Gene Aliases	AU019492; 9030625L19Rik
Spec:SwissProtID	Q922E8
NCBI Reference	O70273
Aliases /Synonyms	ETS domain-containing transcription factor
Reference	PX-P4620
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “ETS homologous factor (Ehf )”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.