Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

ETS homologous factor (Ehf )

Host species:
Escherichia coli (E.coli)
Origin species:
House Mouse
Uniprot ID:
O70273
Molecular weight:
14.97kDa

Original price was: €92.00.Current price is: €83.00.

50ug 10% OFF + 83 loyalty points
Met1–Asn127 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

ETS homologous factor (Ehf )

Product name ETS homologous factor (Ehf )
Uniprot ID O70273
Uniprot link https://www.uniprot.org/uniprot/O70273
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNLEHHHHHH
Molecular weight 14.97kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn127
Protein Accession O70273
Spec:Entrez GeneID 13661
Spec:NCBI Gene Aliases AU019492; 9030625L19Rik
Spec:SwissProtID Q922E8
NCBI Reference O70273
Aliases /Synonyms ETS domain-containing transcription factor
Reference PX-P4620
Note For research use only
Molecular Constructor
Met1–Asn127 His
Product name ETS homologous factor (Ehf )
Uniprot ID O70273
Uniprot link https://www.uniprot.org/uniprot/O70273
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNLEHHHHHH
Molecular weight 14.97kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn127
Protein Accession O70273
Spec:Entrez GeneID 13661
Spec:NCBI Gene Aliases AU019492; 9030625L19Rik
Spec:SwissProtID Q922E8
NCBI Reference O70273
Aliases /Synonyms ETS domain-containing transcription factor
Reference PX-P4620
Note For research use only
Molecular Constructor
Met1–Asn127 His
Product name PX-P4620-1MG
Uniprot ID O70273
Uniprot link https://www.uniprot.org/uniprot/O70273
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNLEHHHHHH
Molecular weight 14.97kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn127
Protein Accession O70273
Spec:Entrez GeneID 13661
Spec:NCBI Gene Aliases AU019492; 9030625L19Rik
Spec:SwissProtID Q922E8
NCBI Reference O70273
Aliases /Synonyms ETS domain-containing transcription factor
Reference PX-P4620
Note For research use only
Molecular Constructor
Met1–Asn127 His

ETS homologous factor (Ehf )

There are no reviews yet.

Be the first to review “ETS homologous factor (Ehf )”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products