Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

G1-S specific cyclin-D1(CCND1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P24385
Molecular weight:
20.69 kDa

210.00

50ug + 210 loyalty points
His Leu65–Arg245
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

G1-S specific cyclin-D1(CCND1)

Product name G1-S specific cyclin-D1(CCND1)
Uniprot ID P24385
Uniprot link https://www.uniprot.org/uniprot/P24385
Expression system Prokaryotic expression
Sequence LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR
Molecular weight 20.69 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu65-Arg245
Protein Accession P24385
Spec:Entrez GeneID 595
Spec:NCBI Gene Aliases BCL1; PRAD1; U21B31; D11S287E
Spec:SwissProtID Q6LEF0
NCBI Reference P24385
Aliases /Synonyms B-cell lymphoma 1 protein,BCL-1,BCL-1 oncogene,PRAD1 oncogene,BCL1, PRAD1
Reference PX-P4712
Note For research use only
Molecular Constructor
His Leu65–Arg245
Product name G1-S specific cyclin-D1(CCND1)
Uniprot ID P24385
Uniprot link https://www.uniprot.org/uniprot/P24385
Expression system Prokaryotic expression
Sequence LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR
Molecular weight 20.69 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu65-Arg245
Protein Accession P24385
Spec:Entrez GeneID 595
Spec:NCBI Gene Aliases BCL1; PRAD1; U21B31; D11S287E
Spec:SwissProtID Q6LEF0
NCBI Reference P24385
Aliases /Synonyms B-cell lymphoma 1 protein,BCL-1,BCL-1 oncogene,PRAD1 oncogene,BCL1, PRAD1
Reference PX-P4712
Note For research use only
Molecular Constructor
His Leu65–Arg245

There are no reviews yet.

Be the first to review “G1-S specific cyclin-D1(CCND1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products