Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade

Product name Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade
Uniprot ID P17931
Source CAS: 2669063-84-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Mac-2 antigen, Lectin L-29, LGALS3, Galactose-specific lectin 3, 35 kDa lectin, Galactoside-binding protein, CBP 35, L-31, Gal-3, Laminin-binding protein, Galectin-3, GALBP, IgE-binding protein, Carbohydrate-binding protein 35, MAC2
Reference PX-TA1960
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade
Uniprot ID P17931
Source CAS: 2669063-84-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Mac-2 antigen, Lectin L-29, LGALS3, Galactose-specific lectin 3, 35 kDa lectin, Galactoside-binding protein, CBP 35, L-31, Gal-3, Laminin-binding protein, Galectin-3, GALBP, IgE-binding protein, Carbohydrate-binding protein 35, MAC2
Reference PX-TA1960
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1960-50
Uniprot ID P17931
Source CAS: 2669063-84-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Mac-2 antigen, Lectin L-29, LGALS3, Galactose-specific lectin 3, 35 kDa lectin, Galactoside-binding protein, CBP 35, L-31, Gal-3, Laminin-binding protein, Galectin-3, GALBP, IgE-binding protein, Carbohydrate-binding protein 35, MAC2
Reference PX-TA1960
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade

Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade: A Promising Antibody for Mac-2 Antigen Targeted Therapy

Introduction

Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade is a monoclonal antibody (mAb) that has been developed as a biosimilar to the original Oloctinebart mAb. It specifically targets the Mac-2 antigen, a protein that is overexpressed in various types of cancer and inflammatory diseases. This biosimilar has been extensively studied and has shown promising results in preclinical and clinical trials, making it a potential therapeutic option for a wide range of diseases.

Structure of Oloctinebart Biosimilar

Oloctinebart Biosimilar is a recombinant humanized IgG1 mAb, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The variable regions of the heavy and light chains are responsible for the specific binding to the Mac-2 antigen, while the constant regions determine the antibody’s effector functions.

Activity of Oloctinebart Biosimilar

Oloctinebart Biosimilar binds specifically to the Mac-2 antigen, which is a transmembrane glycoprotein that is highly expressed on the surface of cancer cells and activated immune cells. This binding leads to the inhibition of Mac-2 antigen signaling pathways, resulting in the suppression of tumor growth and inflammation. Additionally, Oloctinebart Biosimilar has been shown to induce antibody-dependent cellular cytotoxicity (ADCC), which further enhances its anti-tumor activity.

Application of Oloctinebart Biosimilar

Oloctinebart Biosimilar has shown promising results in preclinical studies, exhibiting potent anti-tumor activity in various types of cancer, including breast, lung, and colon cancer. It has also demonstrated efficacy in inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease. In addition, Oloctinebart Biosimilar has been found to have a favorable safety profile, with no significant adverse effects reported in clinical trials.

Clinical Trials

Oloctinebart Biosimilar has undergone several clinical trials to evaluate its safety and efficacy. In a phase I study, it was found to be well-tolerated and showed promising anti-tumor activity in patients with advanced solid tumors. A phase II trial in patients with metastatic breast cancer also showed encouraging results, with a significant increase in progression-free survival compared to standard treatment. Currently, Oloctinebart Biosimilar is in phase III trials for various types of cancer and inflammatory diseases.

Conclusion

Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade is a promising antibody that specifically targets the Mac-2 antigen, a protein that is overexpressed in cancer and inflammatory diseases. Its unique mechanism of action and favorable safety profile make it a potential therapeutic option for a wide range of diseases. With ongoing clinical trials, Oloctinebart Biosimilar has the potential to become a valuable treatment option for patients in need.

Keywords

Antibody, therapeutic target, Mac-2 antigen, biosimilar, monoclonal antibody, cancer, inflammatory diseases, preclinical, clinical trials, safety, efficacy.

SDS-PAGE for Research Grade Oloctinebart

SDS-PAGE for Research Grade Oloctinebart

Research Grade Oloctinebart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Oloctinebart Biosimilar - Anti-Mac-2 antigen mAb - Research Grade

There are no reviews yet.

Be the first to review “Oloctinebart Biosimilar – Anti-Mac-2 antigen mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products