Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Galectin3 (GAL3) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P17931
Molecular weight:
27.17kDa

Original price was: €248.00.Current price is: €210.00.

50ug 15% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Galectin3 (GAL3) recombinant protein

Product name Human Galectin3 (GAL3) recombinant protein
Uniprot ID P17931
Uniprot link http://www.uniprot.org/uniprot/P17931
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Molecular weight 27.17kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms LGALS3, CBP35, GALBP, GALIG, MAC2, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, Laminin-binding protein, Lectin L-29
Reference PX-P4050
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Galectin3 (GAL3) recombinant protein
Uniprot ID P17931
Uniprot link http://www.uniprot.org/uniprot/P17931
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Molecular weight 27.17kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms LGALS3, CBP35, GALBP, GALIG, MAC2, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, Laminin-binding protein, Lectin L-29
Reference PX-P4050
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P4050-1MG
Uniprot ID P17931
Uniprot link http://www.uniprot.org/uniprot/P17931
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Molecular weight 27.17kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms LGALS3, CBP35, GALBP, GALIG, MAC2, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, Laminin-binding protein, Lectin L-29
Reference PX-P4050
Note For research use only
Molecular Constructor
Full-length Yes

General Information about Human Galectin3 (GAL3) recombinant protein

Galectin-3 is a member of the animal lecithin family that binds selectively to β-galactoside residues. The protein is secreted from the cell by exocytosis, which is not related to the classic secretion pathway through the endoplasmic reticulum / Golgi network. Galectin-3 is related to the inhibition of apoptosis and the development of cancer. It is usually distributed in epithelial cells of various organs, several inflammatory cells (including macrophages), dendritic cells and Kupffer cells. The expression of this lectin is regulated during inflammation, cell proliferation, cell differentiation and transactivation of viral proteins. The recombinant Galectin-3 protein was expressed in E. coli and purified by conventional chromatography techniques.

Human Galectin3 (GAL3) recombinant protein

There are no reviews yet.

Be the first to review “Human Galectin3 (GAL3) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products