Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Theralizumab Biosimilar – Anti-CD28 mAb – Research Grade

Isotype:
IgG4

Original price was: €108.00.Current price is: €84.00.

50ug 22% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Product name PX-TA1927-50
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Clonality Monoclonal Antibody
Product name Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source TGN1412, TAB08, CAS: 906068-56-2
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28,TGN1412, TAB08
Reference PX-TA1927
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4
Clonality Monoclonal Antibody

Introduction

Theralizumab Biosimilar, also known as Anti-CD28 mAb, is a research grade monoclonal antibody that has been developed as a potential therapeutic agent for various diseases. This antibody targets the CD28 protein, which is found on the surface of T cells and plays a crucial role in the activation and proliferation of these immune cells. In this article, we will delve into the structure, activity, and potential applications of Theralizumab Biosimilar.

Structure of Theralizumab Biosimilar

Theralizumab Biosimilar is a recombinant, fully humanized monoclonal antibody that is produced in a mammalian cell expression system. It is composed of two identical heavy chains and two identical light chains, each of which is made up of approximately 450 amino acids. The antibody has a molecular weight of approximately 150 kDa and is a member of the immunoglobulin G (IgG) class of antibodies.

Activity of Theralizumab Biosimilar

Theralizumab Biosimilar specifically targets the CD28 protein, which is a co-stimulatory molecule found on the surface of T cells. Upon binding to CD28, this antibody blocks the interaction between CD28 and its ligands, CD80 and CD86, which are expressed on antigen-presenting cells. This results in the inhibition of T cell activation and proliferation, leading to a decrease in the production of pro-inflammatory cytokines and the suppression of immune responses.

Applications of Theralizumab Biosimilar

Theralizumab Biosimilar has shown potential in the treatment of various diseases, particularly those involving dysregulated immune responses. Some of the potential applications of this antibody are discussed below.

1. Autoimmune Diseases Theralizumab Biosimilar has shown promise in the treatment of autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis. In these conditions, the immune system mistakenly attacks healthy tissues, leading to chronic inflammation and tissue damage. By inhibiting T cell activation, Theralizumab Biosimilar can help suppress the immune response and alleviate symptoms of these diseases.

2. Organ Transplantation Organ transplantation often requires the use of immunosuppressive drugs to prevent rejection of the transplanted organ. Theralizumab Biosimilar has the potential to be used as an alternative or adjunct to these drugs, as it can specifically target T cells without affecting other immune cells. This could potentially reduce the risk of infections and other side effects associated with traditional immunosuppressive therapies.

3.

Cancer Immunotherapy

The activation of CD28 on T cells is also involved in the anti-tumor immune response. Theralizumab Biosimilar has been studied as a potential immunotherapy for various types of cancer, including melanoma, lung cancer, and lymphoma. By inhibiting CD28, this antibody can enhance the anti-tumor immune response and potentially improve the efficacy of other cancer treatments.

4.

Infectious Diseases

Theralizumab Biosimilar has also shown potential in the treatment of infectious diseases, particularly those caused by viruses. By inhibiting T cell activation, this antibody can help control the immune response and prevent excessive inflammation, which is often a major contributor to tissue damage in viral infections.

Conclusion

In conclusion, Theralizumab Biosimilar is a research grade monoclonal antibody that specifically targets the CD28 protein on T cells. By inhibiting T cell activation, this antibody has shown potential in the treatment of various diseases, including autoimmune diseases, organ transplantation, cancer, and infectious diseases. Further research and clinical trials are needed to fully understand the therapeutic potential of Theralizumab Biosimilar and its role in the treatment of these diseases.

SDS-PAGE for Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

SDS-PAGE for Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Theralizumab Biosimilar - Anti-CD28 mAb - Research Grade

There are no reviews yet.

Be the first to review “Theralizumab Biosimilar – Anti-CD28 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products