Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Olintatug Biosimilar – Anti-RU2AS mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Olintatug Biosimilar - Anti-RU2AS mAb - Research Grade

Product name PX-TA2205-50
Uniprot ID Q9UBP8
Source CAS: 2851870-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-RU2AS, Kidney-associated antigen 1, KAAG1, RU2 antisense gene protein
Reference PX-TA2205-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Olintatug Biosimilar - Anti-RU2AS mAb - Research Grade
Uniprot ID Q9UBP8
Source CAS: 2851870-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-RU2AS, Kidney-associated antigen 1, KAAG1, RU2 antisense gene protein
Reference PX-TA2205-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Olintatug Biosimilar - Anti-RU2AS mAb - Research Grade
Uniprot ID Q9UBP8
Source CAS: 2851870-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-RU2AS, Kidney-associated antigen 1, KAAG1, RU2 antisense gene protein
Reference PX-TA2205-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Olintatug Biosimilar – Anti-RU2AS mAb is a therapeutic antibody that has been developed as a biosimilar to the original anti-RU2AS monoclonal antibody (mAb). This biosimilar has been designed to have a similar structure, activity, and application as the original mAb, but at a lower cost. In this article, we will discuss the structure, activity, and application of Olintatug Biosimilar – Anti-RU2AS mAb in detail.

Structure of Olintatug Biosimilar – Anti-RU2AS mAb

Olintatug Biosimilar – Anti-RU2AS mAb is a monoclonal antibody that has been produced using recombinant DNA technology. It is a humanized antibody, meaning that it contains both human and mouse components. The antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains consist of constant and variable regions, while the light chains only have variable regions.

The variable regions of Olintatug Biosimilar – Anti-RU2AS mAb are responsible for binding to the therapeutic target, which in this case is RU2AS. These regions have been specifically engineered to have a high affinity for RU2AS, allowing for effective targeting and binding.

Activity of Olintatug Biosimilar – Anti-RU2AS mAb

The main activity of Olintatug Biosimilar – Anti-RU2AS mAb is to bind to RU2AS and inhibit its function. RU2AS is a therapeutic target that is involved in a variety of diseases, including autoimmune disorders and cancer. By binding to RU2AS, Olintatug Biosimilar – Anti-RU2AS mAb prevents it from interacting with its natural ligands and disrupting its activity.

In addition to its inhibitory activity, Olintatug Biosimilar – Anti-RU2AS mAb also has an effector function. This means that it can activate the immune system to target and destroy cells that express RU2AS, such as cancer cells. This dual mechanism of action makes Olintatug Biosimilar – Anti-RU2AS mAb a potent therapeutic agent.

Application of Olintatug Biosimilar – Anti-RU2AS mAb

Olintatug Biosimilar – Anti-RU2AS mAb has a wide range of potential applications in the field of medicine. Its primary use is in the treatment of diseases that are associated with overexpression of RU2AS, such as rheumatoid arthritis, psoriasis, and certain types of cancer.

In addition to its therapeutic applications, Olintatug Biosimilar – Anti-RU2AS mAb can also be used in research settings. Its high specificity and affinity for RU2AS make it a valuable tool for studying the role of this therapeutic target in various diseases. It can also be used in diagnostic assays to detect the presence of RU2AS in patient samples.

Conclusion

In conclusion, Olintatug Biosimilar – Anti-RU2AS mAb is a promising therapeutic antibody that has been developed as a biosimilar to the original anti-RU2AS mAb. Its structure, activity, and application are similar to that of the original mAb, but at a lower cost. With its dual mechanism of action and potential applications, Olintatug Biosimilar – Anti-RU2AS mAb holds great promise in the treatment of various diseases and in furthering our understanding of the role of RU2AS in health and disease.

SDS-PAGE for Olintatug Biosimilar - Research Grade

SDS-PAGE for Olintatug Biosimilar - Research Grade

Olintatug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Olintatug Biosimilar – Anti-RU2AS mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products