Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mk-4721 Biosimilar – Anti-PSCA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade

Product name Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade
Uniprot ID O43653
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mk-4721,AGS-PSCA,MK-4721,PSCA,anti-PSCA
Reference PX-TA1121
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade
Uniprot ID O43653
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mk-4721,AGS-PSCA,MK-4721,PSCA,anti-PSCA
Reference PX-TA1121
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1121-50
Uniprot ID O43653
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mk-4721,AGS-PSCA,MK-4721,PSCA,anti-PSCA
Reference PX-TA1121
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Mk-4721 Biosimilar is a novel monoclonal antibody (mAb) that targets the prostate stem cell antigen (PSCA). This biosimilar is currently in the research grade stage and has shown promising results in preclinical studies. In this article, we will discuss the structure, activity, and potential applications of Mk-4721 Biosimilar as an anti-PSCA mAb.

Structure of Mk-4721 Biosimilar

Mk-4721 Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of Mk-4721 Biosimilar is designed to specifically bind to PSCA, while the constant region is responsible for the effector functions of the antibody.

Activity of Mk-4721 Biosimilar

As an anti-PSCA mAb, Mk-4721 Biosimilar binds to PSCA, a cell surface protein that is overexpressed in various types of cancer, including prostate, bladder, and pancreatic cancer. The binding of Mk-4721 Biosimilar to PSCA leads to the inhibition of PSCA signaling pathways, which are known to promote tumor growth and survival. This results in the suppression of tumor growth and potentially the induction of tumor cell death.

Furthermore, Mk-4721 Biosimilar has been shown to have potent antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) activities. These effector functions of the antibody can enhance the destruction of cancer cells by recruiting immune cells to the site of the tumor.

Application of Mk-4721 Biosimilar

Mk-4721 Biosimilar has shown promising results in preclinical studies as a potential treatment for various types of cancer. Its specificity for PSCA makes it a promising therapeutic option for cancers that overexpress this protein. Some potential applications of Mk-4721 Biosimilar are discussed below.

1. Prostate cancer: Prostate cancer is the second most common cancer in men worldwide. PSCA is highly expressed in prostate cancer cells, making it an ideal target for Mk-4721 Biosimilar. In preclinical studies, Mk-4721 Biosimilar has shown significant antitumor activity against prostate cancer cells, both in vitro and in vivo.

2. Bladder cancer: PSCA is also overexpressed in bladder cancer, and its expression level is associated with tumor aggressiveness and poor prognosis. Mk-4721 Biosimilar has shown promising results in preclinical studies as a potential treatment for bladder cancer, with the potential to improve patient outcomes.

3. Pancreatic cancer: PSCA is highly expressed in pancreatic cancer, and its expression level is associated with tumor progression and metastasis. Preclinical studies have shown that Mk-4721 Biosimilar can effectively inhibit the growth of pancreatic cancer cells, making it a promising therapeutic option for this aggressive cancer.

4. Other cancers: PSCA is also overexpressed in other types of cancer, such as renal cell carcinoma and ovarian cancer. Mk-4721 Biosimilar has shown potential as a treatment for these cancers in preclinical studies, and further research is needed to explore its potential in these indications.

Conclusion

Mk-4721 Biosimilar is a novel monoclonal antibody that targets PSCA, a protein that is overexpressed in various types of cancer. Its structure, activity, and potential applications make it a promising therapeutic option for prostate, bladder, pancreatic, and other types of cancer. Further research and clinical trials are needed to determine the efficacy and safety of Mk-4721 Biosimilar in treating these cancers.

SEC-HPLC of Research Grade MK-4721

SEC-HPLC of Research Grade MK-4721

Research Grade MK-4721was analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Research Grade MK-4721

SDS-PAGE for Research Grade MK-4721

Research Grade MK-4721, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Research Grade MK-4721

Flow Cytometry results for Research Grade MK-4721

Flow-cytometry using anti-human PSCA antibody. HPAC cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human PSCA monoclonal antibody (Catalog PX-TA1121, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Mk-4721 Biosimilar - Anti-PSCA mAb - Research Grade

  • Vele — April 6, 2022

    Great product!

  • Vele — April 6, 2022

    Great product!

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products