Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research

Isotype:
IgG1, kappa

Original price was: €102.00.Current price is: €84.00.

50ug 18% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research

Product name Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nirsevimab, MEDI-8897, RSV, anti-RSV, Nirsevimab Biosimilar
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nirsevimab, MEDI-8897, RSV, anti-RSV, Nirsevimab Biosimilar
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1530-50
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nirsevimab, MEDI-8897, RSV, anti-RSV, Nirsevimab Biosimilar
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Nirsevimab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Nirsevimab,MEDI-8897,RSV,anti-RSV
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Nirsevimab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Nirsevimab,MEDI-8897,RSV,anti-RSV
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody

Nirsevimab Biosimilar, also known as Anti-RSV mAb, is a monoclonal antibody (mAb) that is designed to target and neutralize the respiratory syncytial virus (RSV). This biosimilar is a highly specific and potent therapeutic agent that has been developed using advanced biotechnology techniques.

The structure of Nirsevimab Biosimilar is composed of two heavy chains and two light chains, which are joined together by disulfide bonds. The heavy chains consist of a constant region and a variable region, while the light chains only have a variable region. The variable regions of both the heavy and light chains are responsible for the specific binding and neutralization of RSV.

The constant region of Nirsevimab Biosimilar is derived from human immunoglobulin G1 (IgG1), which is the most abundant antibody isotype in the human body. This constant region provides stability and effector functions to the biosimilar, allowing it to effectively target and neutralize RSV.

The Activity of Nirsevimab Biosimilar – Anti-RSV mAb

Nirsevimab Biosimilar is a potent and specific mAb that targets the F protein of RSV. This protein is essential for the virus to enter and infect host cells. By binding to the F protein, Nirsevimab Biosimilar prevents RSV from entering and infecting cells, effectively neutralizing the virus.

In addition to its neutralizing activity, Nirsevimab Biosimilar also has effector functions that help to clear RSV-infected cells. These functions include antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). ADCC involves the recruitment and activation of immune cells, such as natural killer cells, to kill RSV-infected cells. CDC, on the other hand, involves the activation of the complement system to destroy RSV-infected cells.

The combination of neutralizing and effector functions makes Nirsevimab Biosimilar a highly effective therapeutic agent against RSV. It not only prevents the virus from replicating and spreading, but also helps to clear infected cells from the body.

The Application of Nirsevimab Biosimilar – Anti-RSV mAb

Nirsevimab Biosimilar is a promising therapeutic agent for the prevention and treatment of RSV infections. RSV is a leading cause of respiratory infections, particularly in infants and young children, and can also cause severe illness in older adults and individuals with weakened immune systems.

This biosimilar has shown promising results in preclinical and clinical studies, demonstrating its ability to neutralize RSV and reduce the severity of RSV infections. It has also been shown to have a favorable safety profile, with no serious adverse events reported in clinical trials.

Nirsevimab Biosimilar is currently in the research grade stage, and further studies are being conducted to evaluate its efficacy and safety in different populations. If approved, it has the potential to provide a much-needed treatment option for RSV infections, especially in high-risk individuals.

In addition to its therapeutic applications, Nirsevimab Biosimilar also has potential research applications. Its highly specific and potent activity against RSV makes it a valuable tool for studying the virus and developing new treatments and prevention strategies.

Related Assay Development

In addition to antibody reagents, Nirsevimab is also frequently used in assay development workflows. For example, antibodies targeting RSV may serve as controls or reference reagents in immunoassays such as ELISA designed to study antibody binding or viral antigen detection.

Dedicated ELISA tools may be used alongside monoclonal antibodies in studies requiring antibody quantification or assay validation.

Conclusion

In summary, Nirsevimab Biosimilar – Anti-RSV mAb is a highly specific and potent monoclonal antibody that targets and neutralizes RSV. Its unique structure and effector functions make it a promising therapeutic agent for the prevention and treatment of RSV infections. Further research and clinical trials are needed to fully evaluate its potential, but it has the potential to make a significant impact in the fight against RSV.

What is the price of Nirsevimab biosimilar?

The price of the Nirsevimab biosimilar depends on the selected size and format. Current pricing is displayed directly on the product page for each available quantity.

Nirsevimab biosimilar anti-RSV F protein antibody SDS-PAGE validation

Nirsevimab biosimilar anti-RSV F protein antibody SDS-PAGE validation

Nirsevimab Biosimilar - Anti-Fusion glycoprotein F0 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

ELISA binding of Nirsevimab biosimilar to HRSV-A2 prefusion F protein

ELISA binding of Nirsevimab biosimilar to HRSV-A2 prefusion F protein

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade (cat. No.PX-TA1530) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 8.851M.

Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research

  • Taylor Slade-Adjei — August 14, 2024

    The shipping and customer service is always exceptional!

  • jurata-orders — August 14, 2024

    Solid mAb choice for assay development.

  • Denise Reaves — August 14, 2024

    It’s pretty weak, recommend high concentrations when using in neutralization assay

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products