Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein

  • PX-P6126
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
HRSV-A2
Uniprot ID:
P03420
Molecular weight:
63.15 kDa

420.00

100ug + 420 loyalty points
Met1–Leu513 amp; C-Strep His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein

Product name HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein
Uniprot ID P03420
Origin species HRSV-A2
Expression system Eukaryotic expression
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELL
Molecular weight 63.15 kDa
Protein delivered with Tag? C-Terminal His & C-Strep Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Leu513
Aliases /Synonyms F, Fusion glycoprotein F0, Fusion glycoprotein F2, p27, Intervening segment, Pep27, Peptide 27, Fusion glycoprotein F1, Drug Target,Human Respiratory Syncytial Virus (HRSV), RSV
Reference PX-P6126
Note For research use only.
Molecular Constructor
Met1–Leu513 amp; C-Strep His

Palivizumab Biosimilar - Anti-RSV mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Palivizumab Biosimilar - Anti-RSV mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind to Palivizumab Biosimilar - Anti-RSV mAb (cat. No.PX-TA1057) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in ELISA assay

Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in ELISA assay

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade (cat. No.PX-TA1530) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 8.851M.

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind to Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb (cat. No.PX-TA1429) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein

There are no reviews yet.

Be the first to review “HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products