Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Luvagrobart Biosimilar - Anti-Beta-nerve growth factor mAb - Research Grade

Product name PX-TA2127-50
Uniprot ID P01138
Source CAS: 2768355-18-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2127
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Luvagrobart Biosimilar - Anti-Beta-nerve growth factor mAb - Research Grade
Uniprot ID P01138
Source CAS: 2768355-18-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2127
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Luvagrobart Biosimilar - Anti-Beta-nerve growth factor mAb - Research Grade
Uniprot ID P01138
Source CAS: 2768355-18-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2127
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb

Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb is a novel biosimilar antibody that has been developed for the treatment of various neurological disorders. This biosimilar is a monoclonal antibody (mAb) that specifically targets the beta isoform of nerve growth factor (NGF). NGF is a protein that plays a crucial role in the development and maintenance of the nervous system. Dysregulation of NGF has been linked to various neurological disorders, making it an attractive therapeutic target. Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb offers a promising treatment option for these disorders.

Structure of Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb

Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb is a recombinant humanized monoclonal antibody. It is a genetically engineered version of a mouse antibody, with certain regions replaced by human sequences to reduce the risk of immune reactions. This antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains consist of the variable region, responsible for binding to the target, and the constant region, which determines the antibody’s effector functions. The light chains also have a variable region and a constant region. The overall structure of Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb allows it to specifically bind to NGF and exert its therapeutic effects.

Activity of Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb

Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb exerts its activity by specifically binding to the beta isoform of NGF. This binding prevents the interaction of NGF with its receptors, TrkA and p75, thereby inhibiting the downstream signaling pathways. This leads to a decrease in the production of pro-inflammatory cytokines and pain mediators, as well as a reduction in nerve growth and survival. Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb also promotes the clearance of NGF from the system, further reducing its activity. These mechanisms make Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb an effective therapeutic option for various neurological disorders.

Application of Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb

Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb has shown promising results in preclinical and clinical studies for the treatment of various neurological disorders. It has the potential to be used as a disease-modifying therapy for conditions such as Alzheimer’s disease, Parkinson’s disease, and multiple sclerosis. In Alzheimer’s disease, Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb can reduce the production of amyloid-beta plaques, which are a hallmark of the disease. In Parkinson’s disease, it can promote the survival of dopaminergic neurons that degenerate in this condition. In multiple sclerosis, Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb can inhibit the inflammatory response and promote remyelination. These therapeutic effects make Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb a promising treatment option for these and other neurological disorders.

Conclusion

Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb is a novel biosimilar antibody that specifically targets the beta isoform of NGF. Its structure, activity, and application make it a promising treatment option for various neurological disorders. Further research and clinical trials are needed to fully understand the potential of this biosimilar in the treatment of these conditions. However, Luvagrobart Biosimilar – Anti-Beta-nerve growth factor

SDS-PAGE for Research Grade Luvagrobart

SDS-PAGE for Research Grade Luvagrobart

Research Grade Luvagrobart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SDS-PAGE for Research Grade Luvagrobart

SDS-PAGE for Research Grade Luvagrobart

Research Grade Luvagrobart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Luvagrobart Biosimilar - Anti-Beta-nerve growth factor mAb - Research Grade

There are no reviews yet.

Be the first to review “Luvagrobart Biosimilar – Anti-Beta-nerve growth factor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products