Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Picankibart Biosimilar – Anti-SGRF mAb – Research Grade

  • PX-TA1963-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Picankibart Biosimilar - Anti-SGRF mAb - Research Grade

Product name Picankibart Biosimilar - Anti-SGRF mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS: 2622900-74-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-SGRF, IL-23-A, IL-23 subunit alpha, Interleukin-23 subunit p19, IL23A, Interleukin-23 subunit alpha, IL-23p19
Reference PX-TA1963
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Picankibart Biosimilar - Anti-SGRF mAb - Research Grade
Uniprot ID Q9NPF7
Source CAS: 2622900-74-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-SGRF, IL-23-A, IL-23 subunit alpha, Interleukin-23 subunit p19, IL23A, Interleukin-23 subunit alpha, IL-23p19
Reference PX-TA1963
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1963-50
Uniprot ID Q9NPF7
Source CAS: 2622900-74-5
Species Human
Expression system XtenCHO
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-SGRF, IL-23-A, IL-23 subunit alpha, Interleukin-23 subunit p19, IL23A, Interleukin-23 subunit alpha, IL-23p19
Reference PX-TA1963
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Picankibart Biosimilar – Anti-SGRF mAb

Picankibart Biosimilar – Anti-SGRF mAb is a monoclonal antibody (mAb) that targets the Sonic Hedgehog (SHH) signaling pathway. It is a biosimilar version of the original anti-SGRF mAb, which has been developed for research purposes. This biosimilar offers a more cost-effective and accessible option for researchers studying the SHH pathway and its role in various diseases.

Structure of Picankibart Biosimilar – Anti-SGRF mAb

Picankibart Biosimilar – Anti-SGRF mAb is a recombinant humanized monoclonal antibody that is produced in Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 150 kDa and consists of two identical heavy chains and two identical light chains. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL and CL2) and one variable domain (VL). The variable domains of the heavy and light chains form the antigen-binding site, which specifically recognizes the SHH protein.

Activity of Picankibart Biosimilar – Anti-SGRF mAb

Picankibart Biosimilar – Anti-SGRF mAb exerts its activity by binding to the SHH protein and blocking its interaction with its receptor, Patched (PTCH). This prevents the activation of the SHH signaling pathway, which is involved in cell proliferation, differentiation, and survival. By inhibiting this pathway, Picankibart Biosimilar – Anti-SGRF mAb can modulate various cellular processes and potentially have therapeutic effects in diseases where the SHH pathway is dysregulated.

Application of Picankibart Biosimilar – Anti-SGRF mAb in Research

Picankibart Biosimilar – Anti-SGRF mAb has a wide range of applications in research, particularly in the study of the SHH signaling pathway and its role in various diseases. Some specific applications include:

1.

Cancer Research: The SHH pathway has been implicated in the development and progression of various cancers, including basal cell carcinoma, medulloblastoma, and pancreatic cancer. Picankibart Biosimilar – Anti-SGRF mAb can be used to study the effects of SHH pathway inhibition on cancer cells and potentially develop new therapeutic strategies.

2. Developmental Biology: The SHH pathway plays a crucial role in embryonic development, and its dysregulation can lead to birth defects. Picankibart Biosimilar – Anti-SGRF mAb can be used to study the effects of SHH pathway inhibition on embryonic development and potentially identify new targets for birth defect prevention.

3. Neurological Disorders: The SHH pathway has been linked to various neurological disorders, including Alzheimer’s disease, Parkinson’s disease, and amyotrophic lateral sclerosis (ALS). Picankibart Biosimilar – Anti-SGRF mAb can be used to investigate the role of the SHH pathway in these disorders and potentially develop new treatments.

4. Wound Healing: The SHH pathway is involved in wound healing and tissue regeneration. Picankibart Biosimilar – Anti-SGRF mAb can be used to study the effects of SHH pathway inhibition on wound healing and potentially improve the healing process.

Conclusion

In summary, Picankibart Biosimilar – Anti-SGRF mAb is a recombinant humanized monoclonal antibody that targets the SHH signaling pathway. Its structure, activity, and application make it a valuable tool for researchers studying the SHH pathway and its role in various diseases. With its cost-effectiveness and accessibility, this biosimilar offers a promising option for furthering our understanding of the SHH pathway and potentially developing new therapeutic interventions.

Research Grade Picankibart in ELISA Assay

Research Grade Picankibart in ELISA Assay

Research Grade Picankibart can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Picankibart

SDS-PAGE for Research Grade Picankibart

Research Grade Picankibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Picankibart Biosimilar - Anti-SGRF mAb - Research Grade

There are no reviews yet.

Be the first to review “Picankibart Biosimilar – Anti-SGRF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products