Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mipletamig Biosimilar – Anti-IL-3R subunit alpha;CD3e mAb – Research Grade

  • PX-TA2200-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide

Original price was: €174.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mipletamig Biosimilar - Anti-IL-3R subunit alpha;CD3e mAb - Research Grade

Product name PX-TA2200-50
Uniprot ID P26951 & P07766
Source Bispecific, Tetravalent, CAS: 2839556-21-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2200-100
Note For research use only. Not suitable for human use.
Isotype Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide
Clonality Monoclonal Antibody
Product name Mipletamig Biosimilar - Anti-IL-3R subunit alpha;CD3e mAb - Research Grade
Uniprot ID P26951 & P07766
Source Bispecific, Tetravalent, CAS: 2839556-21-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2200-100
Note For research use only. Not suitable for human use.
Isotype Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide
Clonality Monoclonal Antibody
Product name Mipletamig Biosimilar - Anti-IL-3R subunit alpha;CD3e mAb - Research Grade
Uniprot ID P26951 & P07766
Source Bispecific, Tetravalent, CAS: 2839556-21-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2200-100
Note For research use only. Not suitable for human use.
Isotype Ig IG chain scFvkh-G1hCH2CH3-scFvhk dimer bisdisulfide
Clonality Monoclonal Antibody

Introduction:
Mipletamig Biosimilar is a therapeutic antibody that targets the IL-3 receptor subunit alpha and CD3e protein. It is a research grade antibody that has shown promising results in preclinical studies and is currently undergoing clinical trials for potential therapeutic applications.

Structure:
Mipletamig Biosimilar is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is a humanized antibody, meaning that it contains both human and mouse components, making it less likely to elicit an immune response in patients. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of constant and variable regions, while the light chains only have variable regions. The variable regions are responsible for binding to the IL-3 receptor subunit alpha and CD3e protein.

Activity:
Mipletamig Biosimilar specifically targets the IL-3 receptor subunit alpha and CD3e protein, which are both important components of the immune system. The IL-3 receptor subunit alpha is a cytokine receptor that is expressed on the surface of various immune cells, including T cells, B cells, and natural killer cells. The CD3e protein is a signaling molecule that is also found on the surface of T cells. By targeting these proteins, Mipletamig Biosimilar can modulate immune responses and potentially treat various immune-related disorders.

Application:
Mipletamig Biosimilar is being developed as a potential treatment for a variety of immune-related disorders, including autoimmune diseases, inflammatory disorders, and hematological malignancies. In preclinical studies, the antibody has shown promising results in reducing inflammation and suppressing immune responses. It has also been shown to have anti-tumor activity in certain types of cancer. Currently, Mipletamig Biosimilar is undergoing clinical trials to evaluate its safety and efficacy in treating these conditions.

Therapeutic Target: IL-3 Receptor Subunit Alpha
The IL-3 receptor subunit alpha is a cytokine receptor that is involved in the regulation of immune responses. It is expressed on the surface of various immune cells, including T cells, B cells, and natural killer cells. The binding of IL-3 to its receptor activates signaling pathways that promote cell growth and differentiation. Dysregulation of the IL-3 receptor subunit alpha has been implicated in various immune-related disorders, making it an attractive therapeutic target for Mipletamig Biosimilar.

Therapeutic Target: CD3e Protein
CD3e is a signaling molecule that is found on the surface of T cells. It plays a crucial role in T cell activation and proliferation. The binding of Mipletamig Biosimilar to CD3e can modulate T cell activity and potentially treat immune-related disorders. Dysregulation of CD3e has been linked to autoimmune diseases and hematological malignancies, further highlighting its importance as a therapeutic target for Mipletamig Biosimilar.

Conclusion:
Mipletamig Biosimilar is a promising therapeutic antibody that targets the IL-3 receptor subunit alpha and CD3e protein. Its unique structure and mechanism of action make it a potential treatment option for a variety of immune-related disorders. As it continues to undergo clinical trials, Mipletamig Biosimilar has the potential to improve the lives of patients suffering from these conditions.

SDS-PAGE for Mipletamig Biosimilar - Research Grade

SDS-PAGE for Mipletamig Biosimilar - Research Grade

Mipletamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mipletamig Biosimilar - Research Grade in WB Assay

Mipletamig Biosimilar - Research Grade in WB Assay

Mipletamig Biosimilar - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Mipletamig Biosimilar – Anti-IL-3R subunit alpha;CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products