Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vibecotamab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Vibecotamab ELISA Kit

Vibecotamab ELISA Kit

Product name Vibecotamab ELISA Kit
Uniprot ID P26951 & P07766
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX215
Note For research use only.
Sample type Plasma, Serum
Target Vibecotamab
Immunogen Vibecotamab

Introduction

Vibecotamab is a promising antibody that has been recently developed as a potential therapeutic target for the treatment of various diseases. This antibody has gained significant attention due to its unique structure and activity, making it a valuable tool for researchers and clinicians. In this article, we will provide a detailed description of Vibecotamab ELISA Kit, highlighting its structure, activity, and potential applications.

Structure of Vibecotamab ELISA Kit

Vibecotamab is a monoclonal antibody that specifically targets the protein CD3, which is found on the surface of T-cells. The antibody is composed of two heavy chains and two light chains, which are held together by disulfide bonds. The heavy chains consist of a constant region and a variable region, while the light chains contain only a variable region. The variable regions of both the heavy and light chains are responsible for the specificity of the antibody, as they bind to the target protein.

Activity of Vibecotamab ELISA Kit

Vibecotamab is a highly specific antibody that binds to the CD3 protein on T-cells with high affinity. This binding triggers a cascade of events that ultimately leads to the activation and proliferation of T-cells. The antibody acts as a bridge between T-cells and target cells, such as cancer cells, facilitating the destruction of these cells by the immune system. It also promotes the production of cytokines, which are important signaling molecules that regulate the immune response.

Application of Vibecotamab ELISA Kit

The unique structure and activity of Vibecotamab make it a valuable tool for various applications in the field of research and clinical practice. Some of the potential applications of Vibecotamab ELISA Kit are listed below:

1.

Cancer therapy: Vibecotamab has shown promising results in the treatment of various types of cancer, including leukemia, lymphoma, and solid tumors. The antibody targets cancer cells and activates T-cells, leading to their destruction. It has also been found to enhance the effects of other anti- cancer therapies, making it a potential combination therapy option.

2. Autoimmune diseases: Vibecotamab has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. By activating T-cells, the antibody helps in suppressing the overactive immune response that is responsible for these diseases.

3. Immunotherapy: Immunotherapy is a rapidly growing field that focuses on using the body’s immune system to fight diseases. Vibecotamab has the potential to be used as a therapeutic agent in various immunotherapeutic approaches, such as adoptive cell therapy and chimeric antigen receptor (CAR) T-cell therapy.

4. Diagnostic tool: Vibecotamab ELISA Kit can also be used as a diagnostic tool to measure the levels of CD3 protein in the blood. Changes in the levels of this protein can indicate the presence of certain diseases, making it a valuable tool for disease diagnosis and monitoring.

Conclusion

In conclusion, Vibecotamab ELISA Kit is a highly specific antibody that has shown great potential in the treatment of various diseases. Its unique structure and activity make it a valuable tool for researchers and clinicians, with potential applications in cancer therapy, autoimmune diseases, immunotherapy, and diagnostics. Further research and clinical trials are needed to fully understand the potential of this antibody and its role in improving human health.

Vibecotamab ELISA Kit

There are no reviews yet.

Be the first to review “Vibecotamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products