Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Luveltamab Biosimilar – Anti-FOLR1 mAb – Research Grade

  • PX-TA1862-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €357.00.Current price is: €259.00.

50ug 27% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

Product name Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Luveltamab,,FOLR1,anti-FOLR1
Reference PX-TA1862
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade
Uniprot ID P15328
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Luveltamab,,FOLR1,anti-FOLR1
Reference PX-TA1862
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1862-50
Uniprot ID P15328
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Luveltamab,,FOLR1,anti-FOLR1
Reference PX-TA1862
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Luveltamab Biosimilar

Luveltamab Biosimilar, also known as Anti-FOLR1 mAb, is a novel monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody Farletuzumab. It is a highly specific antibody that targets the folate receptor alpha (FOLR1), a protein that is overexpressed in many types of cancer cells. Luveltamab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials as a potential treatment for various types of cancer.

Structure of Luveltamab Biosimilar

Luveltamab Biosimilar is a recombinant humanized monoclonal antibody that is composed of two identical heavy chains and two identical light chains. The heavy chains consist of a constant region and a variable region, while the light chains consist of a constant region and a variable region. The variable regions of both the heavy and light chains are responsible for binding to the FOLR1 protein.

The constant regions of Luveltamab Biosimilar are derived from human antibodies, making it less likely to cause an immune response in patients. This is an important factor in the development of biosimilars, as they must demonstrate similar efficacy and safety profiles to the original therapeutic antibody.

Mechanism of Action

Luveltamab Biosimilar works by binding to the FOLR1 protein on the surface of cancer cells. This binding triggers a series of events that ultimately leads to the death of the cancer cell. One of the main mechanisms of action of Luveltamab Biosimilar is antibody-dependent cellular cytotoxicity (ADCC), where the antibody binds to the cancer cell and activates immune cells, such as natural killer cells, to attack and kill the cancer cell.

In addition to ADCC, Luveltamab Biosimilar also inhibits the growth and proliferation of cancer cells by blocking the interaction between FOLR1 and its ligands, such as folate and vitamin B9. This prevents the cancer cells from obtaining essential nutrients for their survival and growth.

Applications of Luveltamab Biosimilar

Luveltamab Biosimilar is being developed as a potential treatment for various types of cancer, including ovarian, lung, breast, and endometrial cancer. These cancers are known to overexpress FOLR1, making it an ideal therapeutic target for Luveltamab Biosimilar.

In preclinical studies, Luveltamab Biosimilar has shown promising results in inhibiting the growth and proliferation of cancer cells, as well as inducing cell death. It has also demonstrated a good safety profile, with no significant adverse effects observed.

Clinical Trials

Luveltamab Biosimilar is currently being evaluated in a phase I clinical trial for the treatment of advanced solid tumors. The primary objective of this trial is to assess the safety and tolerability of Luveltamab Biosimilar in patients, as well as to determine the recommended dose for future studies.

In addition, Luveltamab Biosimilar is also being evaluated in combination with other cancer therapies, such as chemotherapy and immune checkpoint inhibitors, in clinical trials for various types of cancer. These trials aim to assess the efficacy of Luveltamab Biosimilar in combination with other treatments and to determine its potential as a first-line or second-line therapy.

Conclusion

Luveltamab Biosimilar is a promising novel monoclonal antibody that targets the FOLR1 protein, which is overexpressed in many types of cancer cells. Its unique mechanism of action, through both ADCC and inhibition of FOLR1 signaling, makes it a potential treatment option for various types of cancer. With ongoing clinical trials, Luveltamab Biosimilar has the potential to provide a safe and effective treatment option for patients with cancer.

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade binds to Recombinant Mouse FOLR1 Protein, N-His in ELISA Assay

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade binds to Recombinant Mouse FOLR1 Protein, N-His in ELISA Assay

Recombinant Mouse FOLR1 Protein, N-His(cat. No.ARO-P10585) at 0.5µg/mL (100µL/well) can bind Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

SDS-PAGE for Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Luveltamab Biosimilar - Anti-FOLR1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Luveltamab Biosimilar – Anti-FOLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products